KEGG   Columba livia (rock pigeon): 102090559Help
Entry
102090559         CDS       T02912                                 

Definition
(RefSeq) glucosylceramidase
  KO
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
clv  Columba livia (rock pigeon)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102090559
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102090559
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    102090559
Enzymes [BR:clv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102090559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 507 aa AA seqDB search
MGAAVVLGWLLLLLVVAPPATGGRPCNAKDFGHGSQVCACSATYCDTLDPVVLPAPGTYV
KYESSKAGKRLERSQGSFQRSLRAPDLILTVDVTQRYQKVKGFGGSITDAAAINILSLPE
TAQDHLLRSYFSEEGLEYNLIRIPMASCDFSLHAYTYDDVPFDYELAHFSLRDEDTKMKI
PLLHRALAMSKQPLSLYASPWTSPTWMKSSESFVGKGTLKGQAGDKYHKTWANYFVRFLD
EYAKHNLTFWAVTAENEPTAGLINNYPFQCLGFTAEQQRDFIARDLGPALANSSHRHIRL
IILDDNRIQLPHWAKVVLEDEEAARYVHGIGIHWYLDFIGPIQDTVVPTHELFPDYFILA
TEACIGAHFWERDVILGCWERGNQYSHSILTNLNNYVTGWTDWNLALDLEGGPNWSKNYV
DSPVIVDSSEGVFYKQPMFYHMGHFSKFIPEGSQRVGLVASKQSKKTELEYTAFQRPDGA
VVVVVLNRSPQNVTFGLADTRDIFLQD
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgccgttgtcctgggctggctgctgctgctgctggtggtagcgccaccggcc
acaggtggccgtccctgcaacgccaaggacttcggtcacggctcacaggtgtgcgcctgc
agtgccacgtactgtgacacgctggaccccgtggtgctgccggccccgggcacctacgtc
aagtacgagagcagcaaggccggcaagcggctggagcgcagccaggggagcttccagcgc
agcctgcgcgccccagatctcatcctgactgtggacgtgacgcagcggtaccagaaggtg
aagggttttggtggctccatcaccgacgcagctgccatcaacatcctttccctgccagaa
acagcccaggatcacctgctccgctcgtacttctctgaggaagggctggagtacaacctc
atccgcatccccatggccagctgtgacttctccctccacgcctacacctacgacgacgtt
ccctttgactacgagcttgcccacttcagcctgcgagacgaggacaccaagatgaagatc
cccctcctgcaccgagccttggccatgagcaagcagccgctgtcgctgtacgcgagtccc
tggacctccccgacctggatgaagagcagcgagtcctttgtggggaagggcacgctgaag
ggacaggcaggggacaagtaccacaagacctgggccaactactttgtacggttcctggat
gaatacgccaagcacaacttgaccttctgggcggtgacggcggagaacgagcccacggcc
gggctgatcaacaactaccccttccagtgcctggggttcacggctgagcagcagcgggac
ttcatcgcgcgggacctgggccccgcgctggccaacagctcccaccgccacatccgcctc
atcatcctggacgacaaccgcatccagctcccgcactgggccaaagtggtcctggaggac
gaggaagcagctcgttacgtccacggcatcggcatccactggtacctggacttcatcggt
cccatccaggacacggtggtgcccactcacgagctgttccccgactacttcatcctggcc
accgaggcgtgcatcggcgcccatttctgggagcgggacgtcatcctgggctgctgggag
cgggggaaccagtacagccacagcatcctgacgaacctcaacaactacgtgaccggctgg
accgactggaacctggccctggacctggaggggggacccaactggagcaagaactacgtg
gacagccccgtcatcgtggacagcagtgaaggtgtcttctacaagcagcccatgttctac
cacatggggcacttcagtaagttcatccccgagggctcccagcgcgtggggctcgtcgcc
tccaaacagtccaagaagacagagctggaatacacggctttccagcgccccgacggtgcc
gtggtggtggtggttctgaatcggtccccgcagaacgtcaccttcggcttggccgacacc
agggacatatttctccaggattga

DBGET integrated database retrieval system