KEGG   Columba livia (rock pigeon): 102090627Help
Entry
102090627         CDS       T02912                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
clv  Columba livia (rock pigeon)
Pathway
Inositol phosphate metabolism
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102090627 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    102090627 (PIK3CG)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102090627 (PIK3CG)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102090627 (PIK3CG)
Membrane trafficking [BR:clv04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102090627 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 1106 aa AA seqDB search
MELGDYEQPVVMREENKRRRRRMKPHCTSSNLSSMELISIEFILPTSNKHTKVPEMMLLE
IAGNCTVEQMKAQIWMRAIEMSQTADFYHAFTPDQFILQYQKKGQWYEIYDKHQVLQTLD
CILYWKVLQKKVGKIYVVQKQKPSEEVQEFQRQLNDLIGYDVTDVSNVHDDELEFTRRRL
VTPRMIEVACRDPKLYAMHPWTTSKPLPEYLFKKITNNNIFIIIHRGTTSQKIKVSIDDT
PDMILHSFFTKMAKKKSLMDIPEDHSELDFVLRICGRDEYITGETPIKDFHWIRQCLKNG
EEIHLVLDNPPDPNEDEVQKEEWPLVDDCTGVTGYHEQLTIDGKDHERVFTISLWDCNRK
FRVKIIGIDIPVLPRNTDLTVFVEANIQHGQQLLSQRRTSSKPFTEEVLWNIWLEFDIKI
KDLPKGALLNLQIYCGKAQGLSTKTNLQSHESPNSDSKCKTQLLYYVNLLLIDHRFLLRS
GEYVLHMWKIPGKGEEQGSINADKLTSATNPDKENSMAISIVLDKYCHPIALPKHRITSD
PQGDRTRAEMPNQLRKQLEEIIATDPLNPLSPEDKELLWHFRYESIKHPKAYPKLLSSVK
WGQQEIVAKTYQLLAKKEVWDQSTLDVGLTMQLLDCNFSDENVRAMAVQKLESLEDDDVL
HYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSMHYQQRFAVIL
EAYLRGCGKAMLHDFMKQVQVIELLHKVTMEIKSVSAEKYDVTSQVIAQLRQKLEKLQSS
KLPESFRVPYDPGLRAGALVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDD
LRQDMLILQILRIMESIWEAESLDLCLLPYGCISTGNKIGMIEIVKDATTIAKIQQSTVG
NTGAFKDEILNQWLKERCMIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITET
GNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFHKFQDVCVKAY
LALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEDDAKKHFLDQIEVCRD
KGWTVQFNWFLHLVLGIKQGVEKHSA
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atggagttgggggattatgaacagcccgttgttatgagagaggaaaacaagcgaaggaga
agaaggatgaaacctcattgtacatcgagtaatttgtcgtcaatggagctgatatccatt
gagttcattttacccacaagcaacaaacatactaaagtaccggaaatgatgttactcgaa
atagctggcaactgtacggttgagcaaatgaaagcacagatttggatgcgtgcaatagag
atgagtcaaaccgcagacttctaccatgcattcaccccagatcagtttattctgcagtat
cagaagaaagggcagtggtatgagatttatgataagcatcaagtattacagacattagac
tgcatattgtactggaaagtattacagaagaaggtgggcaagatctatgttgtccagaaa
caaaaaccatcagaagaagttcaggaatttcagcggcagcttaacgacttaattggttac
gatgtcactgatgtaagcaacgtgcatgatgatgagctagaatttacccgtcgcaggtta
gtcactccacgaatgatagaggtagcctgtagagatcccaaattgtatgcaatgcaccca
tggactacgtctaaaccactcccagaatatttatttaaaaagatcactaataataacatt
ttcataatcatacatagaggaacaactagccaaaaaattaaagtgtcaatagatgacacg
ccagatatgattctccatagctttttcacaaaaatggcaaagaaaaagtctttgatggac
attcctgaagatcatagtgaactggattttgttctcaggatttgcggcagagacgagtac
attactggagagacaccaatcaaagattttcactggataagacaatgccttaagaatggg
gaagagatccaccttgtcttagacaatccccctgacccaaatgaggatgaggttcagaag
gaagagtggcccttggtggatgactgtacaggagttacagggtatcatgaacaattgaca
atagatggaaaagatcatgagagagttttcactatctcattgtgggattgtaataggaaa
tttagggtgaaaataattggtattgatatcccagttttaccaagaaatactgatctcact
gtgtttgtggaggctaacattcaacatgggcagcagctcctttcacagaggagaacttca
tcgaagccttttactgaggaggttctgtggaatatttggttggagtttgacatcaaaatc
aaagacttgcctaaaggagcactcctgaatcttcagatatactgcggcaaagcacaggga
ctgtccacaaagacgaaccttcagtcacatgagtcccccaactctgattcaaagtgcaaa
actcagcttctctattacgtaaatcttttgttgatagatcaccgtttcctgctacgcagt
ggggagtatgtgctccacatgtggaaaattccaggcaagggggaagaacaaggaagtatc
aatgcagacaagctcacatcagcaactaacccagataaagagaactcaatggccatttct
attgtgctggacaaatattgtcacccaattgccttgcccaagcacaggataacgtcagac
ccccaaggggacaggacacgagccgaaatgcccaaccagcttcgcaagcaacttgaagaa
atcatagcaactgacccacttaatccactttctcctgaggacaaagaactgttgtggcac
tttagatatgaaagcataaagcaccccaaggcgtatcctaagctgcttagctccgtgaaa
tggggacaacaagaaatagtggccaaaacttaccagttgctagctaagaaggaggtttgg
gatcaaagcactttagatgttggactcacaatgcagcttctggactgtaacttttcggat
gaaaatgttcgagcaatggcagttcaaaaactggaaagtttagaagatgatgatgttctt
cattatcttttacagcttgtgcaggctgtgaaatttgagccgtatcatgacagcgcatta
gccagatttctgctcaaacgtggtttgagaaacaaaagaattggtcacttcttgttttgg
ttcttaagaagcgagattgcccagtccatgcattaccagcagaggtttgcggtcatcctg
gaagcctatcttaggggctgtggaaaagcaatgctacatgatttcatgaagcaggttcaa
gtaattgaattgctgcataaagtcacgatggagataaaatcagtttctgcagaaaagtat
gatgtcacttctcaagttattgcacagctgagacaaaagcttgaaaaactacagagcagc
aaacttccagaaagttttagagttccatatgatcctgggctcagagcaggagccctggtg
atagaaaaatgtaaagtaatggcatctaagaagaaacccctctggcttgagtttaaatgt
gcagatccaacagctctatcaaatgaaaccataggcataatcttcaaacatggagatgac
ctccgtcaggacatgcttattttacagattcttcgaattatggaatccatttgggaagca
gaatccttggacctctgtttgttaccgtatggttgtatttctacaggaaacaaaatagga
atgatcgaaattgtgaaagatgctacaacaattgccaaaattcagcagagtacagttgga
aacactggtgcatttaaggatgaaatactgaaccagtggctcaaggaaagatgcatgatt
gaagagaagtttcaggcagctgtggaaagatttgtttattcttgtgctggatactgtgtg
gcaacctttgtgcttggaataggagacaggcacaatgacaacatcatgattacagaaaca
ggtaaccttttccatattgattttggccatattcttgggaattataaaagcttccttgga
attaataaggaaagagttccttttgtgctgactccagatttcctgtttgtcatggggact
tccggaaagaagacaagtctccatttccataaatttcaggacgtatgcgtgaaggcttat
ttagctcttcgacatcacacaaacctgctgatcatcctgttctccatgatgctaatgact
ggaatgccccagttaaccagcaaagaggatattgaatatatccgggatgcgctgacagta
gggaaaagcgaagacgatgccaaaaagcattttctcgatcagatagaggtttgcagagat
aagggctggactgtgcaatttaactggtttttacatcttgtgcttggaatcaaacaagga
gtagaaaagcattctgcttaa

DBGET integrated database retrieval system