KEGG   Columba livia (rock pigeon): 102090987Help
Entry
102090987         CDS       T02912                                 

Gene name
GPT
Definition
(RefSeq) alanine aminotransferase 1
  KO
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
clv  Columba livia (rock pigeon)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102090987 (GPT)
   00220 Arginine biosynthesis
    102090987 (GPT)
Enzymes [BR:clv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     102090987 (GPT)
Amino acid related enzymes [BR:clv01007]
 Aminotransferase (transaminase)
  Class I
   102090987 (GPT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 1010 aa AA seqDB search
MSPVSPMVPHPPCRPCPFYPVSPRPKHPCIALVPCPPCPRPLHVPCVPHGPTSPMSPLSL
LPRVPTSQTSLYRSCPVSPVSPSPPCPLCPPWSHIPHVALVPFTPCPHVPNIPVSLLSRV
PRVPVPSMSPVSPMVPHPPCRPCPFYPVSPRPKHPCIALVPCPPCPRPLHVPCVPHGPTS
PMSPLSLLPRVPTSQTSLYRSCPVSPVSPSPPCPLCPPWSHIPHVALVPFTPCPHVPNIP
VSLLSRVPRVPVPSMSPVSPMVPHPPCRPCPFYPVSPRPKHPCIALVPCPPCPRPLHVPC
VPHGPTSPMSPLSLLPRVPTSQTSLYRSCPVSPVSPSPPCPLCPPWSHIPHVALVPFTPC
PHVPNIPVSLLSRVPRVPVPSMSPVSPMVPHPPCRPCPFYPVSPRPKHPCIALVPCPPCP
RPLHVPCVPHGPTSPMSPLSLLPRVPTSQTSLYRSCPVSPVSPSPPCPLCPPWSHIPHVA
LVPFTPCPHVPNIPVSLLSRVPRVPVPSMSPVSPMVPHPPCRPCPFYPVSPRPKHPCIAL
VPCPPCPRPLHVPCVPHGPGPIVTRATQLERELQQGASKPFTEVIKANIGDAHAMGQKPI
TFLRQVTALCVYPELMNDKSIPSDAKDRAKRLLAACGGQSAGAYSASPGIELVRQHVARF
LQQRDGVAADPQNIFLATGASDAIVVILKLLASGSGASRTGVLVPIPQYPLYSATIAELS
AVQLGYYLAEEQCWALEVAELRRVLAKGRQHCCPRVLCIINPGNPTGQVQSRQCIEDVIK
FAYEENLFLMADEVYQDNIYAKGSAFYSFKKVLSEMGPPYSKTVELASFHSISKGFMGEC
GFRGGYMEVINMDPEVKEQLVKLVSVRLCPPVSGQILLGALVDPPQPGEPSYETFMAEKK
AVLSTLAHKAQLTQEIFNKTPGIHCNPVQGAMYSFPRIDLPPRAITAAKEKGQAPDTFFC
MRLLEETGICVVPGSGFGQREGTFHFRMTILPPTEKLKVLLEKLSSFYTE
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctgtgtcccccatggtcccacatcccccatgtcgcccttgtcccttttacccc
gtgtccccacgtcccaaacatccctgtatcgctcttgtcccgtgtcccccgtgtccccgt
cccctccatgtcccctgtgtcccccatggtcccacatcccccatgtcgcccttgtccctt
ttaccccgtgtccccacgtcccaaacatccctgtatcgctcttgtcccgtgtcccccgtg
tccccgtcccctccatgtcccctgtgtcccccatggtcccacatcccccatgtcgccctt
gtcccttttaccccgtgtccccacgtcccaaacatccctgtatcgctcttgtcccgtgtc
ccccgtgtccccgtcccctccatgtcccctgtgtcccccatggtcccacatcccccatgt
cgcccttgtcccttttaccccgtgtccccacgtcccaaacatccctgtatcgctcttgtc
ccgtgtcccccgtgtccccgtcccctccatgtcccctgtgtcccccatggtcccacatcc
cccatgtcgcccttgtcccttttaccccgtgtccccacgtcccaaacatccctgtatcgc
tcttgtcccgtgtcccccgtgtccccgtcccctccatgtcccctgtgtcccccatggtcc
cacatcccccatgtcgcccttgtcccttttaccccgtgtccccacgtcccaaacatccct
gtatcgctcttgtcccgtgtcccccgtgtccccgtcccctccatgtcccctgtgtccccc
atggtcccacatcccccatgtcgcccttgtcccttttaccccgtgtccccacgtcccaaa
catccctgtatcgctcttgtcccgtgtcccccgtgtccccgtcccctccatgtcccctgt
gtcccccatggtcccacatcccccatgtcgcccttgtcccttttaccccgtgtccccacg
tcccaaacatccctgtatcgctcttgtcccgtgtcccccgtgtccccgtcccctccatgt
cccctgtgtcccccatggtcccacatcccccatgtcgcccttgtcccttttaccccgtgt
ccccacgtcccaaacatccctgtatcgctcttgtcccgtgtcccccgtgtccccgtcccc
tccatgtcccctgtgtcccccatggtcccacatcccccatgtcgcccttgtcccttttac
cccgtgtccccacgtcccaaacatccctgtatcgctcttgtcccgtgtcccccgtgtccc
cgtcccctccatgtcccctgtgtcccccatggtcccacatcccccatgtcgcccttgtcc
cttttaccccgtgtccccacgtcccaaacatccctgtatcgctcttgtcccgtgtccccc
gtgtccccgtcccctccatgtcccctgtgtcccccatggtcccacatcccccatgtcgcc
cttgtcccttttaccccgtgtccccacgtcccaaacatccctgtatcgctcttgtcccgt
gtcccccgtgtccccgtcccctccatgtcccctgtgtcccccatggtcccacatccccca
tgtcgcccttgtcccttttaccccgtgtccccacgtcccaaacatccctgtatcgctctt
gtcccgtgtcccccgtgtccccgtcccctccatgtcccctgtgtcccccatggtcccggc
cccatcgtcacccgagccacgcagctggagcgggagctgcagcagggtgcctccaagccc
ttcaccgaggtgatcaaggccaacatcggtgacgcccacgccatgggccagaaacccatc
accttcctccgccaggtgacagccctgtgtgtgtacccagagctcatgaacgacaaatcc
atcccgtcggacgccaaggaccgcgccaagcggctgctggcagcctgcggcggccagagc
gccggtgcctacagcgccagccccggcatcgagctggtgcggcagcacgtggcgcggttc
ctgcagcagcgcgacggcgtcgccgccgacccccagaacatcttcctggccaccggcgcc
agcgatgccatcgtggtcatcctgaagctgctggcgtcgggctcgggggcctcgcgcacg
ggggtgctggtgcccatcccgcagtacccgctgtactcggccaccatcgcggagctcagc
gccgtgcagctggggtactacctggccgaggagcagtgctgggcgctggaggtggccgag
ctgcgccgtgtgctggcaaagggacggcaacactgctgtccccgcgtcctctgcatcatc
aaccccggcaaccctaccggccaggtccagagccgccagtgcatcgaggacgtcatcaag
ttcgcctatgaggagaacctcttccttatggccgatgaggtgtaccaagacaacatctat
gccaagggctcggctttctactctttcaagaaggttctgagcgagatggggccgccctac
tcgaaaacggtggagctggcctccttccactccatctccaagggcttcatgggagagtgc
ggtttccgtggcgggtatatggaggtgataaacatggaccccgaggtgaaggagcagttg
gtcaagctggtgtcggtgcggctgtgcccacccgtgtctgggcagatcctcttgggcgcc
ctcgtggacccaccacaacctggagaaccttcatacgagacattcatggctgagaagaag
gccgtgctcagcaccctggcccacaaggcccagctcacccaggagatcttcaacaagacc
cccggcatccactgcaaccccgtccagggggccatgtactccttcccccgcatcgacctg
ccgccccgcgccatcaccgccgccaaggagaagggtcaagcccccgacacgttcttctgc
atgaggctgctggaggagacggggatctgcgtggtgccgggcagcggtttcgggcagcgc
gagggcaccttccacttccggatgaccatcctcccgcccaccgagaagctgaaggtcctg
ctggagaagctcagcagcttctacaccgag

DBGET integrated database retrieval system