KEGG   Columba livia (rock pigeon): 102091024Help
Entry
102091024         CDS       T02912                                 

Definition
chymotrypsinogen 2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
clv  Columba livia (rock pigeon)
Brite
Enzymes [BR:clv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     102091024
Peptidases [BR:clv01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102091024
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 269 aa AA seqDB search
MALLWLLSCLVLAGSARATLSLASCGVPAIAPIIQGYNRIVNGEAAVPGSWPWQVSLQRN
NGFHFCGGSLISENWVVTAAHCGVRTTDTVVVGAYDQDSPSPDEQRLTIKKVFKNPKFNV
LTIRNDITLIKLATPAQLSATVSPVCLPQATEDFPAGLTCVTTGWGLTDPNASSTPAVLQ
QVALPLLSNVQCKAYWGFRISDVMVCAGADGASSCNGDSGGPLVCQKNGAWTLVGIVSWG
SSTCSPSIPAVYARVTELRPWIDSILAAN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctgtggctgctgagctgcctggtgctggcgggctctgcccgtgccaccctc
tccctggcgagctgcggtgtgcccgccattgcacccatcatccaaggctacaaccgcatc
gtcaacggggaggcagcggtaccaggatcctggccatggcaggtgtccctccagcgcaac
aacggcttccacttctgcggtgggtcgctgatcagtgagaactgggtggtcactgctgca
cactgcggtgtcaggaccactgacaccgtggtggttggtgcttatgaccaggactcacct
tcccctgatgagcagaggctgaccatcaagaaggtcttcaagaaccccaagttcaacgtg
ctgaccatccgcaacgacatcaccctgatcaaactggccacccctgcccagctgtctgcc
actgtgtcacccgtctgcctgccccaggccactgaagacttcccagcgggcttgacctgt
gtcaccactggctgggggctcactgaccccaatgcctcgtcgacaccggcggtgctgcag
caggtggccctgcccctgctcagcaacgtgcagtgcaaggcgtactgggggttccgcatc
agcgacgtgatggtgtgtgccggtgctgatggtgcctcctcctgtaatggcgactccggg
ggcccgctggtgtgtcagaagaatggcgcctggaccctggtgggcatcgtctcctggggc
agcagcacctgcagccccagcatacccgctgtctatgcccgtgtcaccgagctccgcccc
tggatcgactccatcctggcggccaactga

DBGET integrated database retrieval system