KEGG   Columba livia (rock pigeon): 102091500Help
Entry
102091500         CDS       T02912                                 

Gene name
ELP3
Definition
(RefSeq) elongator complex protein 3 isoform X1
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
clv  Columba livia (rock pigeon)
Brite
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102091500 (ELP3)
Transfer RNA biogenesis [BR:clv03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    102091500 (ELP3)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102091500 (ELP3)
   HAT complexes
    Elongator complex
     102091500 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1
Motif
Other DBs
NCBI-GeneID: 102091500
NCBI-ProteinID: XP_021154205
Position
Unknown
AA seq 470 aa AA seqDB search
MCKPHRCPHINFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRV
EQLKQLGHSVDKVEFIVMGGTFMALPEDYRDYFIRNLHDALSGHTSNNVAEAVRYSERSL
TKCVGITIETRPDYCLKRHLSDMLSYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH
LAKDAGFKVVAHMMPDLPNMGLERDMGQFVEFFENPAFRPDGMKLYPTLVIRGTGLYELW
KTGRYKSYPPSTLVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMK
DLGTQCRDVRTREVGIQEIHHKVRPYQIELVRRDYVANGGWETFLSYEDPEQDILVGLLR
LRKCSEESFRAELKGGVSIVRELHVYGSVVPVSSRDPSKFQHQGFGMLLMEEAERIAKEE
HGSWKIAVISGPTTRLNTGCAQLPFNHLDLNRERIMKHFTHSDINNRVRT
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaaccacacaggtgtccgcacattaactttacaggcaacatttgtgtatactgc
ccaggtggacctgattccgattttgaatattcgacacagtcttacacgggatatgagcca
acgtctatgagggccattcgggctagatacgacccttatctgcaaacaagacacagagtg
gaacagctgaagcagttgggccacagtgtggataaagtcgagtttattgtgatgggtgga
acgttcatggccctgcctgaagactacagagattatttcatcagaaaccttcacgatgcc
ttgtcaggtcacacttccaataacgtagcagaggccgtcaggtattcagaacgaagcctg
acaaaatgtgtcgggataaccatagagaccagaccagattactgcctgaagcgacatttg
agcgacatgttgtcctacggctgcacgaggctggaaatcggggtgcagagtgtgtacgag
gacgtggccagggacaccaacagaggtcacaccgtgaaggccgtgtgcgagtcgtttcac
ttagccaaggatgccgggttcaaagtggtggcgcacatgatgcctgatctcccaaacatg
ggcctggaaagggacatgggccagttcgttgagttttttgagaatcccgcctttcgcccg
gacggcatgaagctctatccgacgctggtgatccgcggcacgggtctgtacgagctctgg
aagacgggaagatacaagagctacccccccagcactctcgtggatctggtggccagaatc
ctggcccttgtccccccgtggacacgcgtgtaccgtgttcagagagatatcccgatgccg
ctggtcagctcaggagtggagcacgggaacctgcgcgaactcgccctggccaggatgaaa
gatctggggacgcagtgtcgtgatgtaagaacaagagaggttggaattcaagaaattcac
cataaagtgagaccatatcagattgaattagtccgaagagattatgtggctaatggtggc
tgggagaccttcctgtcctacgaagacccggagcaggacattctcgttgggctcctgcgc
ctgcggaaatgttccgaggagtctttcagagcggagctgaaaggaggagtttccatcgtc
cgcgaactccacgtgtacgggagcgtcgtccccgtgagcagccgggacccttccaaattc
cagcaccagggatttggtatgttactaatggaggaagcagaaagaatagccaaggaggag
cacgggtcatggaaaattgctgtaatttcaggtccaacaaccagactaaatacaggttgt
gcacagttgccgtttaatcatttagacctcaacagagaaaggattatgaaacacttcaca
cacagcgatattaacaatcgtgtgaggacatga

DBGET integrated database retrieval system