KEGG   Columba livia (rock pigeon): 102091620Help
Entry
102091620         CDS       T02912                                 

Gene name
KAT2B
Definition
(RefSeq) histone acetyltransferase KAT2B
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102091620 (KAT2B)
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102091620 (KAT2B)
Transcription machinery [BR:clv03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102091620 (KAT2B)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102091620 (KAT2B)
   HAT complexes
    PCAF complex
     102091620 (KAT2B)
    STAGA complex
     102091620 (KAT2B)
    TFTC complex
     102091620 (KAT2B)
    SAGA complex
     102091620 (KAT2B)
    SLIK complex
     102091620 (KAT2B)
    ADA-HAT complex
     102091620 (KAT2B)
    HAT-A2 complex
     102091620 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_4
Motif
Other DBs
NCBI-GeneID: 102091620
NCBI-ProteinID: XP_021145982
Position
Unknown
AA seq 763 aa AA seqDB search
MDKDCWQRHLQCAHILSRTRMEFRELLPRLEKCEAEESCKCNGWKNPNPPPTPPRAELGQ
AGASLRAGFGFLFCLAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYF
YLFKLLRKCILQMGKPVVEGSLESPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAK
MFLNRINYWHLETPSQRRLRSPNDDIAGYKVNYTRWLCYCNVPQFCDSLPRYETTQVFGR
TLLRSVFTVMRRQLLEQARQEKDKLPQEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDF
MVSSSQTGQLGIQTVISPPPVARSVSYSASPSSLEQPNSGNMSPACKVSSALDPNLGEKR
KNNEPYSLEDSKKPRVVGDIPIELINEVMSTITDPAAMLGPETNFLSAHSARDEAARLEE
RRGVIEFHVVGNSLNQKPNKKIMMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALI
KDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILNFLTYA
DEYAIGYFKKQGFSKDIKVPKAKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEI
IKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKERGKEPKDSDQLY
STLKTILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFM
ADLQRVFTNCREYNPPESEYYKCANILEKFFYTKIKEAGLIDK
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagactgctggcaaagacatcttcagtgtgcacatattctgagcagaacaaga
atggagtttagggagctgctgcccaggttagagaaatgtgaggccgaggaatcctgtaaa
tgcaatggctggaagaaccccaacccgcctcccacgccaccacgggcagagctggggcag
gcgggcgccagcctgcgcgctgggtttggatttttattttgtttagctgctcatgtttct
cacctggagaatgtgtctgaagaagaaatgaacaggctcctggggattgtattggatgtg
gagtatttattcacctgtgtccacaaagaagaagatgcagacaccaagcaagtttatttc
tacctattcaaacttttgaggaagtgcattttacagatgggaaaacctgtagtagaagga
tctttggaaagtcccccatttgagaaacctagcattgaacagggtgtgaataattttgtg
cagtacaaatttagccacttaccctcaaaggaaaggcaaacgatagtggaactggctaaa
atgtttctgaaccgcattaactactggcacctggaaacaccttctcagcgaagactaaga
tcacccaatgatgatatcgcagggtataaagtgaattataccaggtggctttgttattgc
aatgtccctcaattctgtgacagtctacctcggtatgaaaccacccaggtttttggtagg
acattgcttcgctccgtttttactgtaatgagacggcaattactggagcaggccaggcaa
gaaaaagacaagcttcctcaagagaaacgaacactaatcctcacccattttccaaagttt
ctgtcaatgctggaagaagaagtgtacagccagaattctcctatttgggatcaggatttc
atggtgtctagttcccaaactggacagctgggaatccagacagttatcagtcctcctcct
gttgcaagatctgtttcatacagtgcaagtccttcgtctctggaacagcccaacagtggg
aatatgagtcctgcttgcaaagtttcttctgcccttgacccaaacctaggggaaaagaga
aaaaataatgaaccctattctctggaggattcaaaaaaaccaagggttgtaggagacatt
cctattgagttaatcaatgaagtaatgtcaacaattacagatcctgcagcaatgctcggg
ccggagaccaacttcctctcggcgcactcggcccgggacgaggcggcgaggctggaggag
cgcaggggagtgattgaattccacgtggttggcaactccctgaaccagaagcccaacaag
aagatcatgatgtggctggttggtttgcagaacgtcttctcccatcaactgcctcgaatg
ccaaaggagtacatcacacgcttggtctttgatccgaaacacaagacccttgcattaata
aaagatggtcgtgttatcggtggtatctgtttccggatgttcccctcccaaggatttacg
gagattgttttctgtgctgtgacttccaatgagcaagtcaagggttatgggactcaccta
atgaaccatctgaaggaataccacatcaaacacaacattctcaattttctcacatatgca
gatgaatatgctattggctacttcaaaaaacaaggtttttccaaagatattaaagtacca
aaagcaaaatacgttggctacatcaaggattatgagggtgccacattaatgggttgtgaa
ttaaatccaaggatcccctacacggagttttctgttatcattaaaaagcaaaaagagatc
ataaaaaagctcatagaaaggaaacaagctcagataaggaaagtttatcctggcctttct
tgcttcaaagatggagtacggcagattcctatagaaagcattcctggaattagagagact
ggctggaaaccaagcggaaaagaaagaggtaaggagcccaaggattcagatcaactttac
agcacattaaaaaccatcctgcagcaggtgaagagccatcaaagcgcttggcccttcatg
gaacctgtgaagagaacagaagctcctggatattatgaagttataaggtttcccatggat
ctcaaaacaatgagtgagcgactcaagaataggtactacgtgtctaagaaattattcatg
gcagacttgcagcgagtgtttacaaattgcagagagtacaacccccccgagagtgaatac
tacaaatgtgccaatatactggagaaattcttctacacaaaaattaaagaagctggatta
attgataagtga

DBGET integrated database retrieval system