KEGG   Columba livia (rock pigeon): 102091815Help
Entry
102091815         CDS       T02912                                 

Gene name
PADI2
Definition
peptidyl arginine deiminase, type II
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
clv  Columba livia (rock pigeon)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 665 aa AA seqDB search
MSGERTLRLQHGNRIEALCVLGTHISADVYGAAPAGAVSFGVKHTEGVSVEVTCRGQAED
GSATSSGTRWPLDEGTVLRFSMSRASTEVNDNKVTVSFYAEGGQHINQAGVFLTGIGISL
DADADRDGVVEQNNPNKASWTWGPEGHGAILLVSCDKESPFTPASDCDNERVFSKEDLLD
MSRMILRTEGPQRLPRGYKIILYVPVSDADKVGVYYVQNPFFGQRYVQVLGQRKLYHAVQ
YTGGAAELDFFVEGLRFPDETFPGLVSIYVSLLETLAEGIPHTPIFTDMVTFRVAPWIMT
PNTLAPVNVFVCSMKENYLFMKEIKNLVNKAGCELKVCSGYINRGDRWMQDEIEFGYTHA
PHKSFPVVLDSPRDGGMEQLPIKELLGPDFGYVRREPLFEAITSLDSFGYLEVSPPVTVA
GKEYPLGRILIGSSFPTSAGRRMTRAVWDFLYAQQVQAPVELYSDWLAVGHVNEFVTFVP
ASDAKRFRMLMASPAACYKLFREKQKEGQGEATMFKGKGTADTKRVTINKVLSNDILTQQ
NQYVQRCIDWNRDILKKELELTEEDIIDLPTLFKLDKQGKAVPYFPNMVTMMVLAKDLGV
PKPFGPVTGGECCLERRARSLLEPLGLRCRFLEDVSSYHGSLGEVRCGTSVQRRPFTFQW
WRMMP
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggagcgcacattgcggctgcagcacgggaaccgcatcgaggccttgtgcgtg
ctgggcacccatatctccgccgacgtctatggggcggccccagccggggcagtttccttc
ggcgtgaagcacacagagggggtgagcgtggaggtgacgtgccggggccaagcagaggat
ggatcagccaccagcagcgggacacgatggccgctggacgaggggacagtcctgaggttc
agcatgagccgggccagcactgaggtcaacgataacaaggtaaccgtcagcttttatgca
gaaggagggcagcacatcaaccaagctggggtcttcctcaccggcatcggaatctctttg
gacgctgatgcggatcgggacggcgtggtggaacaaaacaaccccaacaaggcaagctgg
acctggggcccggagggacatggagccatcctgctcgtcagctgcgacaaggagagtccc
ttcactccagcatctgactgtgacaatgaaagggtattcagcaaagaagatttgctggat
atgtctcggatgatcttgaggactgaagggccacagcgcctgccccggggatacaaaatc
atcctctatgttcctgtttctgacgccgacaaagttggggtctattatgtgcagaacccc
ttcttcgggcagcgctacgtccaagtgctgggccagaggaagctgtaccatgctgtgcag
tacactggtggggctgccgagctcgacttctttgttgagggtcttcgttttcctgatgaa
accttccctgggctggtctccatctacgtcagcctcctggagacactggctgagggtatc
ccccacactccaatcttcaccgacatggtcacattcagagtagcaccatggatcatgacc
cccaacactttggcaccagtgaatgtctttgtctgcagcatgaaggaaaactacctcttc
atgaaggagatcaaaaacctggtgaacaaagctggctgtgagctgaaggtttgctccggc
tacatcaaccgcggcgaccgctggatgcaggatgagattgagtttggctacactcatgcc
ccccataaaagcttcccagtggtgctggactctcctcgagatggaggaatggagcaactc
cccatcaaggagctgctgggccctgattttgggtacgtgaggcgagagccgctctttgaa
gccattaccagcctcgactccttcggatacctggaggtcagcccacctgtgactgtggcg
gggaaggagtatcccctggggaggatcctcatcggcagcagcttccccacatccgcaggg
aggaggatgaccagggcagtgtgggattttctctatgcccagcaagtccaggctcccgta
gagctctactccgactggttggctgtgggtcacgtcaatgaatttgtcacttttgtgccc
gcctctgatgcaaagcggtttcggatgctgatggccagccccgccgcctgctacaagctc
tttcgagagaagcagaaggagggtcagggtgaagccaccatgttcaaaggcaaggggaca
gcggacacaaaacgcgtcaccattaacaaggtcctttccaacgacatcctgacgcagcag
aaccagtatgtccagcgctgcatcgactggaacagggacatcctgaagaaggagctggag
ctgacggaggaggacatcattgacctacccaccctcttcaagcttgacaagcagggcaaa
gccgtgccctacttccccaacatggtcaccatgatggtcctggccaaggacctgggcgtc
cccaagcccttcggccccgtgacgggaggtgaatgctgcctggagcgacgggcccgttcc
ctcctggagccactgggcctgcgctgccgcttccttgaggatgtgtcctcctaccacggc
agcctgggagaggttcgctgcggcaccagcgtccagcgccggcccttcaccttccaatgg
tggcgcatgatgccatag

DBGET integrated database retrieval system