KEGG   Columba livia (rock pigeon): 102092063Help
Entry
102092063         CDS       T02912                                 

Gene name
NCOA1
Definition
(RefSeq) LOW QUALITY PROTEIN: nuclear receptor coactivator 1
  KO
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
clv  Columba livia (rock pigeon)
Brite
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102092063 (NCOA1)
Chromosome [BR:clv03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102092063 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 1472 aa AA seqDB search
MSGLGDSSTDPANPDSRKRKGSPCDTAQSNEKRRREQENKYLEELAELLSANIGDIDTLS
VKPDKCKILKKTVDQIQQMKRLEQEKAADDEVQKSDISSSSQGVIEKESLGPLLLEALDG
FFFVVNREGRIVFASENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLGKKPP
EVGFFNQLGLAEHCKKHSCVFSDVGLRVVFMYIIYIESSLRADIRRDLGQSGFPWHHFQS
CLICIARRLPRPAAVAPSESFVTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQ
PQGREPSYAKQLFQEVMTRGTAFSPSYRFTLSDGTVLSAHTKCKLCYPTSPEMQPFIMGI
HIIDRDHGMLSPQENTNSAMALPRVSPSLNPSISPGQGMALPPSIPPSNGSMLATNVNQQ
PGAGLHNNSNSSTSQTNFGCSPGNQMGANVALSQGQAGPQNSNHTLNLNSSPMNSPGITP
PQFMSPRHRVSPGLVPRPRVPGNPFSPTMPTMHSPVGMANSGSGAGGATGAARSFPGAPM
NSMQGLAEGPSTPVGYSTPPPVLRQLSSQSSPGRLAMQPMKAESKDSKEIASILSEMIQS
DGGAGDSKPLDSGMLHANDRLSEGDNKCSQATSHKLVQLLASTAEQQLRHADADTSCKDS
LACAGTGGTLASGNPPSSTCPSSHSSLTERHKILHRLLQEGSPSDITTLAMEHEKKESTP
NPTTPPAAPSQLPGASDIKLEPDTLKKKDAKDHQLLRYLLDKDEKELAAAPALSLDDVKV
KVEKTEQMEPCNTAPVPLAKPPATEEVKLETQGQFAAELEQLDQLLPSLEKAAQLPGLCG
ADRNESGVAVKPEMLAGPPPPRAASTPAGLNPMSSAQGVQAGRTPFEFCDPLEPAQLRPV
PCPTSNGSSPHARGPAQQGRGTVTAPNPFPPDTGMPELEMGVPDHQFGQPGMGEQMPWPD
NGMAAMNRGAMGKPEDQCITSQLDELLCPPTTPEGRNDEKALLEQLVSFLSGKDETELAE
LDRALGIDKLVQGGGLEALTERFQPQQATPPLMMEQKPGMYPQPYXKKSPASPTANLPGA
FPGMVRQKPSFGAVPVQVPPPRGAFPSTMAMQPRQTLNRPPTAPNQLRLQLQQRLQGQQQ
LIHQNRQAILNQFAANSPVGINMRAGMQQQITPQVRGMWHGKTSSNRQIPGQQHRQRQLM
QQRAILMRQQSFGNNLPPSAGLPVQIGAARLPQAPPQQFPYPPNYGTSPGNPPTSTSPFS
PLASNPEAALANRGSMVNRGMMGAVGGQFGAGMTPQMQQNIFQYSGSGMGQQSEPAFAPS
LSPSSPLMSPQLPPSQSPMLQPAPPTPGYQSPDMKTWQQGAMGNSNVFSQAGQNQPAPAQ
QGMYNNMSITVSMAGGNTNVQNMNPMAGQMQMNSLQMPGMNSMCSEQVNDAALRPAGLYC
NQLSSTDLLKTEGDGAQVSKKPLSTSQVPPGV
NT seq 4419 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagctcaacggaccctgccaaccccgactcccgcaagaggaaa
ggttcaccctgcgacacagcccagagcaatgaaaagcgccgacgggagcaggagaacaaa
tacttggaggagctggcggagctgctgtctgcaaacatcggggacatcgacacgctgagt
gtcaaacctgacaaatgcaagatcctgaagaagacggttgatcagatccagcagatgaag
aggttggagcaagagaaagcagctgatgatgaagtgcagaagtccgacatctcgtccagc
agccaaggtgtgattgagaaggagtctctgggacctcttctcctagaggcattggatggc
ttcttcttcgtcgtgaaccgcgaagggaggatcgtcttcgcctccgagaacgtgaccagc
tacctgggttataaccaggaggagctcatgaacaccagtgtctacagcatcctgcacgtg
ggggatcacgccgagttcgtcaagaacttgttgccgaagtctctgggtaagaaaccgcct
gaggttggtttttttaatcagctggggcttgcagagcactgtaaaaaacactcttgtgtc
ttcagtgatgttggccttagagtggtttttatgtatattatttatatagaatcttccctg
cgggcagatatccgcagggatttgggacagtcagggttcccttggcaccatttccagtcg
tgtctgatatgcattgcgagacgattacctcgaccagcagccgtcgccccttccgaatcc
ttcgtgaccaagcaagacaccacaggtaaaatcatctccatcgacaccagttccctgcga
gccgccggcaggacgggctgggaggatttggtgcgaaaatgcatctacgctttcttccag
ccgcagggcagagagccgtcctacgccaaacagctgtttcaagaagtgatgacacgcggc
acggccttcagcccctcgtaccgattcaccctgagcgacgggacggtgctcagtgcccac
accaagtgtaagctctgctaccccaccagcccggagatgcagcccttcatcatgggcatc
cacatcatcgacagggatcacggcatgctctcaccccaggagaacactaactccgccatg
gcccttccccgggtcagcccctcgctgaaccccagcatctccccgggccaaggcatggcc
ctgccgccctccatccccccctccaacggcagcatgttggccaccaacgtcaaccagcag
ccaggcgccggcctccacaacaacagcaactccagcaccagccaaaccaacttcggatgt
tcacctgggaaccagatgggagccaacgttgccttaagccagggacaagctggtccccag
aacagtaaccacacgctgaacctcaacagctcccccatgaacagtccggggatcacccca
ccgcagttcatgtccccaaggcatcgggtcagcccggggctggtgcccagaccccgcgtg
cccggcaatcccttctcgcccaccatgcccaccatgcactctcccgtgggcatggccaac
agcggcagcggggccggcggtgccaccggcgccgccagatcctttcccggcgcccccatg
aactccatgcagggcttggccgaaggtcccagcaccccggtgggctactccacaccaccc
cctgtgctgagacagctcagctcgcagagctcgcccggccgcctcgccatgcagcccatg
aaagccgagtccaaggacagcaaggagatcgcctccatcctcagtgagatgatccagtcg
gatggcggggcgggggacagcaaaccgctggattcgggcatgctgcatgccaatgacagg
ctctcagaaggggacaacaagtgctcccaagccaccagccacaagctggtccagcttctg
gccagcacggcggagcagcagcttcgacacgctgacgcagacacgagttgcaaagattcg
ttggcctgtgcgggcaccggtggcaccttggcctctggaaaccctcccagcagcacctgc
ccttcctcccacagctccctgaccgagcggcacaagatcttgcacagactccttcaggag
ggcagcccttcggacatcaccaccctggccatggagcacgagaagaaggagagcacgccg
aaccccaccaccccccccgcagctcccagccagctgccgggagcctcggacatcaaactg
gagccggacacgctgaagaaaaaagacgccaaggatcatcagctcctaaggtatctgctg
gacaaggacgaaaaggaacttgctgcagccccggcactgagcctggacgacgtgaaggtg
aaggtggagaagacggagcagatggagccctgtaacacggccccggtgccactcgccaaa
cctcctgccacggaggaggtcaagctggagacgcagggccagtttgctgccgaactggag
cagctggaccagctgctgccctcgctggagaaggcggcgcagctgcccggcttgtgcgga
gcggacaggaacgagagtggcgtggccgtcaaaccggagatgctggcgggccccccgccg
ccccgcgccgccagcacccccgcgggactcaacccgatgagcagcgcgcagggcgtgcag
gccggtcggacgccctttgagttctgcgaccccctggagccagcgcagctgaggccggtt
ccttgtcccaccagcaatggcagcagcccgcacgcccgcgggccggcccagcagggcagg
ggcacggtcacggctcccaaccccttcccacccgacacagggatgccggagctggagatg
ggggtgccggatcaccagtttggacagccgggaatgggggagcagatgccctggccggat
aacggcatggcagccatgaaccggggcgccatgggtaaacccgaagaccagtgcatcacc
tcgcagctggacgagctcctgtgtccccccaccacgccggaggggcggaacgatgagaag
gctctgctggagcagctcgtctccttcctcagcggcaaagacgagaccgagctggccgag
ctggaccgagctctcggcatcgacaagctggtccagggcggtgggctggaagccctgaca
gaacggttccaaccccaacaagccaccccaccactcatgatggagcagaaacccggcatg
tacccccagccttactaaaaaaaatcccccgcctctcccaccgccaacctccccggcgcc
ttccccggcatggtgaggcagaagccgtcgtttggagccgtgccggtgcaggtccctccg
ccccgcggcgccttccccagcaccatggccatgcagccccggcagacgctcaacaggccc
ccgacggcccccaaccagctgcgacttcagctgcagcagcggctgcagggccagcagcag
ctgatccatcaaaaccggcaagcgatcctcaaccagtttgcagccaattccccggtgggc
atcaacatgcgggcagggatgcagcagcagatcacgccgcaggtaagggggatgtggcat
ggaaaaacatcatcaaatcgtcaaatcccaggccagcagcaccggcagcggcagctcatg
cagcaacgagccatcctgatgagacagcaaagcttcggaaacaacctccccccctccgcc
gggctcccggtgcagatcggagccgctcgcctgccccaagcgcccccccagcagttccct
taccccccaaattacggtacgagcccaggaaaccctcccacctccaccagccccttctca
ccgttggcatccaaccccgaggccgcgctggctaaccgcggcagcatggtgaacaggggg
atgatgggcgccgtcggaggacagttcggcgccgggatgaccccgcagatgcagcagaac
atctttcagtattcgggatcgggcatgggtcagcaaagtgaacccgcctttgccccgtcg
ctcagccccagcagccccttgatgtcaccgcagctgccgccatcgcagagccccatgctg
cagccagcaccgcccacaccgggctaccagtcgccggacatgaagacctggcagcaagga
gccatggggaacagcaacgttttcagccaagcgggacagaaccagccagcgcctgctcag
cagggcatgtacaacaacatgagcatcactgtctccatggcgggaggaaacaccaacgtc
cagaacatgaaccccatggctggacagatgcaaatgaactcgctgcagatgcccgggatg
aattccatgtgctcggagcaggtaaacgacgcggcgctgagacccgcaggcctttactgc
aaccagctttcctccactgaccttttgaaaacagaaggagatggggcgcaggtcagtaag
aaaccgctaagcacatctcaggtacccccaggagtgtaa

DBGET integrated database retrieval system