KEGG   Columba livia (rock pigeon): 102092419Help
Entry
102092419         CDS       T02912                                 

Gene name
MGEA5
Definition
(RefSeq) protein O-GlcNAcase
  KO
K15719  protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
clv  Columba livia (rock pigeon)
Brite
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102092419 (MGEA5)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     102092419 (MGEA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAGidase
Motif
Other DBs
NCBI-GeneID: 102092419
NCBI-ProteinID: XP_021149453
Position
Unknown
AA seq 900 aa AA seqDB search
MAENIVAKLVQTGDDTFRAGYVSEGGDRREREELLCDYPSCTCQRLSFSFLGFYGRPWVM
EQRKELFRRLQKWGLNTYLYAPKDDYKHRMFWREMYSVEEAEQLMTLISAAREHEIEFIY
AISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNMCAADKEVFSSFAHAQ
VSITNEIYQYLGEPDTFLFCPTEYCGTFCYPNVAQSPYLRTVGEKLLPGIEVLWTGPKVV
SKDIPVESIEEVSKIIRRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTNPN
CEFEANYVAIHTLATWYKSNMNGVRKDVVMTDTEDSTVSIQIKLENEGSDEDIETDVLYS
PQMALKLALTEWLQEFGVPQQYSSRQVAHSGAKTTVGDVGPLVAPSSLNAATVVTTVYQE
PIMSQGAALSSESPALIKEEEKKQSDEEPMDMVVEKQDDTDKNANQILTDIAEAKMAEEL
KPMDTDKESIAESKSPEMSMQEDSGSDIAPMQTDEQINKEQFVPGPSEKPLYTVEPVTLE
DLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKDAEKIEEWRNRAAKFEE
MCSLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSQSSAQFLSGDQ
EPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTIRPYFPKDEASVYKICREMY
ADGADQPFHSLPDLIGDKLVGGLLTLSLDYCFVLEDEDGICGYALGTVDVTPFIKKCKMS
WIPFMQEKYTKPNSDKELSEAEKIMLSFHEEQEVLPESFLANFPSLIKIDIHKKVTDPSV
AKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIAKMEGFPKDVVILGRSL
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaacattgtggcgaaactagttcagacaggagatgacacattcagagcaggg
tacgtgtctgaaggaggagataggagagaaagagaagagctgctgtgcgattatcccagc
tgtacatgccagaggctcagcttcagtttcctgggattttatggaagaccttgggttatg
gaacagagaaaagaactttttagaagacttcaaaagtggggactgaacacatacctgtat
gctccaaaggatgactacaagcacaggatgttctggcgagaaatgtactctgtggaggaa
gcagagcagctaatgactctaatatcagctgcacgagagcatgaaatagaattcatctat
gcaatctctcctggacttgacatcactttctccaatcctaaagaggtatccacattgaaa
cgcaagctggaccaggtctcccagtttggctgcaggtcttttgcgctgctgtttgatgat
attgatcacaatatgtgtgcagcagacaaagaagttttcagctcctttgctcatgctcaa
gtctcaatcacaaatgaaatttatcaatatctaggagaaccagacacattccttttctgt
cctacagagtactgtggaactttctgttatccaaatgttgcccagtcgccgtatctacga
actgtaggagaaaagctgctccctggcattgaggtgttatggacaggtccgaaagttgta
tccaaagacattccagtagagtccatagaagaagtttctaagatcatcaggagagcacca
gttatctgggataacattcatgctaatgattatgatcagaagaggctttttcttgggcct
tacaaaggtcggtcaactgagctcatccctcgactaaagggagttctgaccaatcccaac
tgcgagtttgaagccaattatgttgctattcacacgcttgcaacctggtacaagtccaat
atgaatggagtgagaaaagatgtggtgatgactgatactgaagacagtacagtttctatc
cagattaaattggaaaatgaggggagtgatgaagatattgaaacagatgttctctacagc
ccacaaatggccctgaagttggccttaacggaatggttgcaggaatttggagtacctcaa
caatacagcagtaggcaagtggcccacagtggtgctaaaactactgtaggggatgtaggg
cctctggtggcaccatcctctttaaatgcagcaactgtggttaccacagtttaccaggaa
cccatcatgagtcagggggcagcactgagcagtgagtcaccagccttgatcaaggaagaa
gagaagaaacaatctgatgaggaaccaatggacatggtggtggagaaacaagacgacaca
gacaagaatgctaatcaaatactgacagatattgccgaagccaagatggcagaggagttg
aagccaatggataccgataaggagagcatagctgaatcaaagtccccagagatgtctatg
caggaagactctggtagtgacatcgcccctatgcagactgatgagcaaattaacaaagaa
cagtttgtgcctgggccaagcgaaaaacctctctacactgtagagcctgtgacattagag
gacttgcagcttcttgctgacttgttttaccttccttatgaacatgggcccaaaggtgca
caaatgttgagagaattccagtggctcagagcaaatagcagtgttgtcagtgtgaattgc
aaaggaaaggatgctgaaaaaatagaagaatggcgtaaccgagcagccaagtttgaagag
atgtgcagtttggtgatggggatgttcactcgcctctccaattgtgccaacaggacaatc
ctttatgacatgtactcctacgtctgggatatcaagagtattatgtcaatggtgaaatct
tttgtgcagtggttagggtgtcgtagtcaatcttcagcacagttcttaagtggagaccaa
gaaccctgggcctttagaggtggtctagcaggagagttccagcgtttgctgcctattgat
ggggcaaatgacctcttttttcaaccacctccattaacacccacttccaaagtgtacacc
atacgaccctactttcctaaagatgaggcctctgtatataagatctgcagagaaatgtat
gctgatggagctgatcaacccttccatagtttaccagatttgattggagacaagttagta
ggaggtctactcactctcagcctggattactgttttgtcttggaagatgaggatggcata
tgcggctatgctttgggaacagttgatgtgactcctttcattaaaaagtgcaaaatgtct
tggatccctttcatgcaagaaaaatataccaaaccaaatagtgacaaggagctctctgag
gcagagaaaataatgctaagcttccatgaagagcaagaagtattgccagaatcgttcctt
gccaacttcccgtcattgataaagattgatatccacaaaaaagtgacagatccaagcgtg
gccaaaagtatgatggcctgcctgctctcttctctaaaggctaatggctcccgtggggct
ttttgtgaagtgagaccagatgataaaagaatcctggaattttacagcaagctgggttgt
tttgaaattgctaaaatggaaggatttccaaaggatgttgttatccttggaagaagcctg
tga

DBGET integrated database retrieval system