KEGG   Columba livia (rock pigeon): 102092682Help
Entry
102092682         CDS       T02912                                 

Gene name
POMT1
Definition
(RefSeq) protein O-mannosyl-transferase 1 isoform X1
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00514  Other types of O-glycan biosynthesis
clv00515  Mannose type O-glycan biosynthesis
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    102092682 (POMT1)
   00514 Other types of O-glycan biosynthesis
    102092682 (POMT1)
Enzymes [BR:clv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     102092682 (POMT1)
Glycosyltransferases [BR:clv01003]
 O-Glycan biosynthesis
  O-linked Man type
   102092682 (POMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMT PMT_4TMC MIR HPP
Motif
Other DBs
NCBI-GeneID: 102092682
NCBI-ProteinID: XP_013226065
UniProt: A0A2I0M402
Position
Unknown
AA seq 725 aa AA seqDB search
MLGFLKKPVVVTVEINMNLVALTVMGLISRLWGLSYPRAVVFDEVYYGQFVSLYMKRIFF
VDDSGPPLGHMLLALGGYLGGFDGNFLWNRIGAEYGMNVPVWSLRLLPALAGALCVPLAY
QILVELQFSHCAALGAALLILLENSLITQSRFMLLESILIFFILLAVLSYLKFYNLQRHR
SFSGSWWFWLLLTGVACSCAVGVKYMGLFTYMLLLATAGLHFWHMIGDQHLSNVSLMCHF
LARGLALIIIPVAMYLSFFYVHLALLYRSGPHDQIMTSAFQASLEGGLARITQGQPLEVA
YGSQITLRNVLGKPMQCWLHSHTNTYPIRYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
MQQLVVSNPPRPVRHGHIVQLVHGITTRYLNTHDVAAPLSPHSQEVSCYIDYNISMPAQN
LWRVEIVNRESDTDVWKTILSEVRFVHVNTSAVLKLSGASLPEWGYRQLEVVGEKLSKGY
HQSMVWNVEEHRYGKSQEQKEREVELHSPTQMDISKNLSFMAKFTELQWKILTLKNEDTE
HKYSSSALDWITMDTNIAYWLHPTSGAQIHLLGNVVTWASANVAALVYVFLSLWYLIRRR
RKIYDIPKDVWQLWVSAGGICVGGWAVNYLPFFLMEKTLFLYHYLPALTFQILLIPIVLQ
HLGDHLCRSLLLKSMFSALIVAWFSSVYLVYRTFSPVTYGEPSLSAAELKDLRWKDSWNI
LLQKQ
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgttgggatttctgaagaagccggttgtggttactgtggagataaatatgaacctcgtg
gcattgactgtgatgggattaataagccgtctgtgggggctttcctatccacgggctgtc
gttttcgatgaagtttattacggccaattcgtttcgctctacatgaagaggatcttcttt
gtggatgacagcggcccgcctcttggccacatgctgctcgctttgggaggttatttagga
ggatttgatggcaacttcttatggaacaggattggagctgaatatgggatgaacgttcct
gtttggtccttgcggctcctgccagccctggctggtgcgctctgtgtgcctttagcatac
cagattttggtagaactgcagttctcccactgtgctgcacttggagctgctcttctgatt
ctcttagagaactctttgatcactcagtcaaggttcatgcttctggaatcaatattgatt
ttttttatcctacttgcagttttgtcctacttgaagttctacaatttgcaaaggcacagg
tccttctctggaagctggtggttttggctcctgctgactggagtagcttgttcttgtgcg
gttggagtgaaatatatgggcctgtttacctatatgctgctcttggccaccgcaggactc
cacttctggcacatgataggagaccagcacttgtcaaatgtttccttgatgtgccatttc
ctggctagaggactggccctcatcatcatcccggtggcaatgtacctgtccttcttctat
gttcacttggctttgctgtatcgctctgggcctcatgaccagatcatgacaagtgctttt
caagccagcttagagggcgggctggctcggatcactcagggtcagcccttagaggtggcc
tatggctctcagattactctgcggaacgtgttgggcaagcccatgcagtgttggctccat
tctcacacaaatacttatcccatcaggtacgagaatggccgaggcagttcccaccaacag
caggtgacctgctatcccttcaaggatgtgaacaactggtggattgtcaaagatcccgga
atgcagcagctggtggtgagtaacccaccccggcccgtgcggcacggacacatcgtgcag
ctggtccatggcatcacgactcggtacctcaacacgcatgatgttgctgcccctctcagc
ccccactcccaagaagtttcttgctatattgattataacatctccatgccggcgcagaac
ctctggagagtggaaattgtaaatcgggagtctgacacagacgtgtggaagaccattttg
tcagaagtgaggtttgttcacgtgaacacctctgcagtgctaaagctcagtggagcatct
ttacccgagtggggataccggcagctggaggtggttggagagaagctgtccaagggctac
caccagagcatggtgtggaacgtagaagagcacagatacgggaaaagccaagagcaaaaa
gagagggaagtagaactccactctcccacacagatggacataagtaaaaacctcagcttc
atggcaaagttcacagaattgcagtggaaaatcctcacattaaaaaatgaagacacagaa
cataagtacagctcctccgctctcgactggatcacgatggacacaaacattgcgtactgg
ctgcacccgacctctggtgcccagatccacctccttgggaatgttgtcacctgggcttca
gcgaacgttgctgctctggtctatgtctttctgtccctctggtacttgatacggcgaaga
agaaaaatttacgacattcctaaagatgtgtggcagctctgggtatcagccgggggcatc
tgtgttggaggctgggctgtgaattacctgcccttcttcctgatggagaagacgcttttc
ctgtaccactacctgcctgccctcacattccagattctcctgattcccatcgtattgcag
catcttggcgatcatctctgcagatctctgcttctcaagagcatgttcagtgccttgatc
gtagcctggttctcttcagtttacttggtctatcgcacattcagtcctgtgacctatggg
gagccctcgctgtctgctgctgaactcaaggacttgcgctggaaagacagctggaacatc
cttctccaaaaacagtaa

DBGET integrated database retrieval system