KEGG   Columba livia (rock pigeon): 102092811Help
Entry
102092811         CDS       T02912                                 

Gene name
SCD5
Definition
(RefSeq) stearoyl-CoA desaturase 5 isoform X1
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv01040  Biosynthesis of unsaturated fatty acids
clv01212  Fatty acid metabolism
clv03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102092811 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102092811 (SCD5)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     102092811 (SCD5)
Lipid biosynthesis proteins [BR:clv01004]
 Desaturase
  First
   102092811 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 102092811
NCBI-ProteinID: XP_021145118
Position
Unknown
AA seq 282 aa AA seqDB search
MPFSWTLSFCRAPRRRACCLPRGVKNLCSAYFCFLMTALGVTAGAHRLWSHRSYKAKLPL
RIFLAAANSMAFQNDIYEWSRDHRVHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVI
EKGRKLDFTDLLDDPVVRFQRKYYKSSVVLMCFVIPTVVPWYLWGESLWNAYFLASILRY
TISLNVTWLVNSAAHMYGNRPYDKYINPRQNTFVTLGAIGEGFHNYHHTFPFDYSASELG
LKFNPTTWFIDFMFWLGLVTDRKQAPKEMIQARKERTGDGSA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcccttctcttggaccttatccttctgcagggctccaagaaggagagcatgctgcctg
cccaggggagtgaagaacctctgctctgcgtatttctgtttcctgatgacagccctgggc
gtgacggcgggggcgcatcgcctgtggagccaccgttcctacaaagccaagctgcctctg
cggatctttctggctgcagctaactccatggctttccagaacgatatctacgagtggagc
cgagaccaccgtgtgcaccacaagtactccgagacggatgcagacccacacaatgcccga
cgcggcttcttcttctcccacattggctggctctttgtgcgcaagcaccgggacgtcata
gagaaggggaggaaactggatttcaccgacctgctggatgaccctgtcgtcaggttccaa
agaaagtattacaagagttcggtcgtgctgatgtgctttgtgatccctactgttgtgcca
tggtacctctggggggagagtctgtggaatgcctacttccttgcctccatcctacggtac
accatctcccttaatgtcacctggctggtcaacagcgctgcccacatgtatggcaaccgc
ccttatgacaagtacatcaaccccaggcagaacacctttgtaacgctgggagccatcggc
gagggtttccacaactaccaccacaccttcccattcgactactcagccagcgagctgggc
ctgaagttcaaccctaccacctggttcattgacttcatgttttggttggggttggtcact
gaccgcaaacaggctccgaaggaaatgatccaagctcgcaaggaaaggactggagatggc
agcgcttga

DBGET integrated database retrieval system