KEGG   Columba livia (rock pigeon): 102092885Help
Entry
102092885         CDS       T02912                                 

Definition
sialidase-3-like
Orthology
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
clv  Columba livia (rock pigeon)
Pathway
Other glycan degradation
Sphingolipid metabolism
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:clv00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:clv00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 261 aa AA seqDB search
MSQSVTCLKPLPVPPCQQWGDGRETPPSPSPPGSPLGFGETLFRQGNGVTYRIPALLYVP
PTATFLAFAEKRSSARDEDAKFLVLRRGCRDGSSVKWGPLEELSALVLPGRRTMNPCPLY
DATSGVIFLFCICVERGKTERRQIWRGCSAARLCYSPPRGCQGSVVSFPAPAGDTPTWLL
YSHPTDRHRRSDLGVYLNPSPLDGAGWRRPWVLRPGPAGYSDLAVCPGGGFGCLFECGES
SACEEIAFCLFALGEQNLQAF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagtctgtcacctgcctgaagcctctgcctgtgccaccctgccagcagtggggg
gatggccgagagacccccccatccccatcaccaccgggatctccgctcggctttggcgag
acgctgttccggcagggaaacggggtcacctaccgcatcccggctctgctctacgtgccc
cccaccgccaccttcctggcctttgccgagaaacgctcctcagccagggatgaggacgcc
aagttcctggtgctgcgccggggctgccgggacggctcctcggtcaagtggggtccgctg
gaggagctgtcggcgctggtgctgcccggccgccgcaccatgaacccctgtcccctttac
gacgcgacgagcggcgtcatcttcctcttctgcatctgtgtggagcggggcaagacagag
cggcgccaaatctggcggggctgcagcgccgcccgcctctgctattccccgccgcggggg
tgccaggggagcgtggtgagcttccccgcgcccgccggggacacccccacatggttactg
tactcccatcccaccgaccggcaccgccggagcgatttgggcgtctatctcaacccctcg
ccgctggacggggcgggatggaggcgcccgtgggtgctgcgcccggggccggcgggttat
tccgacctggccgtctgtcccggcggcggtttcggctgcttgttcgagtgcggcgagagc
agcgcctgcgaggaaatcgccttctgcctcttcgccctgggcgagcagaacctccaagct
ttttaa

DBGET integrated database retrieval system