KEGG   Columba livia (rock pigeon): 102092927Help
Entry
102092927         CDS       T02912                                 

Gene name
KAT7
Definition
(RefSeq) K(lysine) acetyltransferase 7
  KO
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
clv  Columba livia (rock pigeon)
Brite
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102092927 (KAT7)
Chromosome [BR:clv03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102092927 (KAT7)
   HAT complexes
    HBO1 complex
     102092927 (KAT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 720 aa AA seqDB search
MAQRAGHAWGQHRGARGVAVLAQLATCTHKGYRIAPENCAIPRDNCIWKENAYRTPMAQR
AGHAWGQHRGARGVARNAGSSSDGTEDSDFSTDPEHTDSSESDGASRRSARVTRSSARLS
QSSQDSSPVHNPPSFGAEEPVYSTRRVTRSQQQPAPVTPKKYPLRQTRSSGSETEQVVDF
SDRDTKNAADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSMKDSGSDLSHRP
KRRRFHESYNFNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQ
IEERMLAHRQDDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTY
GNTREPLLENLTSEYDLELFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTW
YHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVD
GKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNY
NVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRY
LHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQIRLCRVLQRSAQ
GRRQRGKRSGAAAQGRKLFRCRQRGPVAVARFWWQGRVVTAVALVREREQAVLAGVCAPR
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcgggccgggcacgcctgggggcaacaccgcggagccagaggagtggcggta
cttgcacaacttgcgacgtgcactcacaagggttacaggattgcccctgagaattgcgca
atccctagagataactgcatttggaaggaaaacgcgtaccgcacacccatggcacagcgg
gccgggcacgcctgggggcaacaccgcggagccagaggagtggcgaggaacgcgggcagc
agctcggatggaacggaggactctgacttctccacggatcccgagcacacggacagctca
gagagcgacggcgcgtcccgccgctcggcccgcgtgacccgctcctccgccaggctcagc
cagagctcccaagattccagcccggttcacaacccgccgtcgttcggagcggaggagccg
gtgtactccacgcgcagggtgacgcgcagccagcagcagcccgctcccgtcacccccaag
aagtacccgctgcgccagacccgctcgtccggctccgagaccgagcaagtggtcgacttt
tctgacagagacactaaaaatgcagcggatcacgatgagtctccacctcgtacccccact
gggaatgccccttcctcagagtctgatattgatatctccagtccaaatgtgtcccacgat
gagagcattgccaaggacatgtccatgaaggattctggaagtgacctgtcccaccgtcct
aagcgccgccgcttccatgagagctacaatttcaacatgaaatgtcccactcctggttgt
aactctttaggacacctgactggaaaacacgagcgccacttttccatctcgggatgcccg
ctgtatcataatctctcagcagatgagtgcaaggtgcgagcgcagagccgggataagcag
atcgaggagaggatgctggcccatcggcaggacgacaacaacaggcacgccaccaggcac
caggcaccaacagagaggcagctgcgatacaaagagaaagtggctgagctccggaagaag
agaaactctggactaagcaaggagcaaaaagaaaaatacatggaacacagacaaacctat
ggcaatactagagaacctctgcttgaaaacctgacgagcgagtacgacctcgagcttttc
cggagagcacaagcacgggcatctgaggacctggaaaagctgcggctccagggccagatc
acagaaggcagcaatatgattaaaacgatcgcgtttggccgttacgagctggacacctgg
tatcattccccctacccagaggagtacgctcgtctgggacgtctctacatgtgcgagttc
tgtctcaaatacatgaagagccagaccatactgcgcaggcacatggcaaaatgtgtttgg
aaacatccaccgggtgatgagatctaccgcaaaggctccatttcagtgtttgaggtggat
gggaagaagaacaagatctactgtcagaacctgtgtctgctggccaaacttttcttggac
cacaaaacgctgtattacgatgttgagcccttcctgttctatgtcatgacagaagctgac
aacactggctgccacctgatcgggtatttctccaaggagaagaattcttttctcaactac
aatgtttcttgtatcctgacgatgcctcaatatatgaggcaaggctacggcaaaatgctc
attgacttcagctatttgctttcgaaagtagaagaaaaggttggctctccagaacggcct
ctgtccgatttgggtctcatcagctaccgcagttactggaaggaagttctgcttcgttac
ctgcataatttccaaggaaaagagatctctataaaagaaatcagccaggagacggcggta
aatcctgtcgacatcgttagcacgttgcaggcgcttcagatgctcaagtactggaaggga
aaacacctggtcctaaagagacagattcgcttatgcagagtcttgcagcggagtgcccag
gggcggcggcagcgcgggaagcgcagcggagcggcggcacagggcagaaagctgttccgc
tgtcgccagcggggcccggtggctgtggcacggttctggtggcagggacgcgttgtgacc
gcggtggctctggtcagggagcgcgaacaggccgtgttggctggggtgtgtgcaccgcgg
taa

DBGET integrated database retrieval system