KEGG   Columba livia (rock pigeon): 102093813Help
Entry
102093813         CDS       T02912                                 

Gene name
BAP1
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase BAP1
  KO
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
clv  Columba livia (rock pigeon)
Brite
Enzymes [BR:clv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102093813 (BAP1)
Peptidases [BR:clv01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102093813 (BAP1)
Ubiquitin system [BR:clv04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    102093813 (BAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 764 aa AA seqDB search
MPGGTGRALGGRHLHPVIASQLDGWITPSSPGSPEAQEPCTVPEQPGAEWSRASPSCCVG
QGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRRKVSTLVDETSV
IDDDIVNNMFFAHQLIPNSCATHALLSVLLNCNNVDLGPTLSRMKDFTKGFSPESKGYAI
GNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRLFELDGLKVYPI
DHGPWADDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRMKYESKLHILKMN
RQTVLEALQQLIRVTQPELIQTQKSQESQPQEEAKPASSKTMAPESTHPDGTDEPPSQGH
PAATQSPPNKSKPAAKTSVSSVNGVLPANPNPIVQRLPAFLDNHNYAKSPMQEEEDLAAG
VGRSRVPVRQHQQYSDDEDDYDDEEEEEGRNTIRYKRKGQVKQEHAAGAADGQLSVLQPN
TINVLAEKLKESQKDLSIPLSIKTSGGGTTVAVVTHSQPSPTPSNESTDTASEIGSAFNS
PLPPPPGTATPTRPSSPVTSHISKVLFGEEDGLLRVDCLRYNRAVRDLGPIISTGLLHLT
EDGVFCPLAAADGGKISPPSIKPGDEAPAAIKLEEKEGSEASDSKEKVGLGRTSDHPGGE
KYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQE
GMLASLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggggcacgggccgagcgctgggagggcggcatctccatcccgtcatcgcttca
caactggacgggtggatcacaccctcttccccaggtagcccagaagctcaagagccctgt
accgtgcctgagcagccgggagcagaatggtcacgggcatccccttcctgctgtgttgga
caaggtctcttcacactcctggttgaagattttggggtcaagggagtgcaggttgaagag
atttatgatctgcagagcaaatgccaaggccctgtgtatgggttcatcttcctgttcaag
tggattgaggagcgcaggtcacgccggaaggtctctaccctggtggatgagacatctgtg
attgatgatgacatcgttaataacatgttctttgctcaccagctgatccccaattcctgt
gccacccacgccctgctgagcgtcctcctgaactgcaacaatgtcgacctgggccccacg
ctgagccgcatgaaggatttcaccaaaggattcagccctgagagcaaaggctacgccatt
ggcaatgccccagagctggccaaggcccacaacagccatgccaggccggagccgcggcac
ttgccggaaaagcagaatggtatcagtgctgtacgaaccatggaggcttttcattttgtc
agctatgtccccatcaagggacggctgtttgagctggatgggctcaaggtctatcccatt
gaccacgggccgtgggctgatgacgaggaatggacagacaaagccaggagagtaatcatg
gagcgcatcggcctggccactgcaggggagccataccatgacatccgcttcaacctgatg
gcagtggtgcctgatcggaggatgaaatatgagtccaaactgcacatcctgaagatgaac
cgccagactgtgctggaggccttgcagcagcttatccgagtaactcagcctgagctgatc
cagacccagaagtctcaggagtctcagcctcaggaagaggcaaagccagccagcagcaag
accatggctccagagagcacccatccagatggcaccgatgagccccccagccagggccac
cctgcagccacacagagcccacccaacaaatccaaaccagcggcaaagacatcagtgagc
agtgtcaatggggtgcttccagcaaaccccaaccccattgtgcagaggttgccagccttc
ctggataaccacaactacgccaagtcccccatgcaggaggaggaagaccttgcggcagga
gtgggtcgcagccgggtgccagtccgacagcaccagcagtattcggatgatgaggatgac
tacgatgatgaggaggaggaggaaggtcgtaacaccatcaggtacaaaaggaaggggcag
gtaaaacaagagcatgcggcgggggctgcagatggccagctctctgtcctccagcccaac
accatcaacgtcctggctgagaagctgaaggaatctcagaaggatctctccattcccctg
tccatcaagacaagcggtggaggcaccactgtggctgtggttacccactcccagccctct
cccacccccagcaacgagagcaccgacaccgcctccgagatcggcagcgccttcaactcc
ccgctgcctcccccccccggcacggccacccccacccgcccctccagccccgtcacctcc
cacatctccaaggtgcttttcggtgaggaggatgggctgctgcgtgtggactgcctgcgc
tacaaccgggctgtcagggacctggggcccatcatcagcactgggctgctgcacctcacg
gaggacggcgtgttctgcccgctggctgccgcagatggggggaaaatctccccaccttcc
atcaaacctggtgatgaggccccggctgcgatcaaactggaggagaaggagggcagtgag
gccagtgacagcaaagagaaggtgggacttggcaggaccagtgatcaccctgggggggaa
aagtattctcccaaggagctactggcactgctgaagtgcgtggaggcagagattgctaac
tacgaggcctgcctgaaggaagaggtagagaagaggaagaaattcaagatcgatgaccag
aggagaacccacaactacgacgagttcatctgtaccttcatctccatgctggctcaggaa
ggcatgctggccagcctcgtggagcagaacatctctgtccgccggcggcagggagtcagc
attggccgcctgcacaagcagaggaagccggatcgccggaaacgctcccgcccctacaaa
gccaagcggcagtag

DBGET integrated database retrieval system