KEGG   Columba livia (rock pigeon): 102094247Help
Entry
102094247         CDS       T02912                                 

Gene name
PPOX
Definition
(RefSeq) LOW QUALITY PROTEIN: protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00860  Porphyrin and chlorophyll metabolism
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    102094247 (PPOX)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     102094247 (PPOX)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     102094247 (PPOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase DUF4244
Motif
Other DBs
NCBI-GeneID: 102094247
NCBI-ProteinID: XP_021152240
Position
Unknown
AA seq 331 aa AA seqDB search
MSPQVSELGLEGDILPVPGDHPASRNRFLYVGGALHKLPSGLGYGQHPVPRATQPARGAG
RLLAPTRRRAALPRTPAPNCRALSVRSCFPALFEAERRRRSVLLGLALPRGSPSQCPQCP
LPGAPHRSASPQLTLDDGTVTADHVISAIPAAALAEVLPAEAXXXXXXARELRHIPAVSV
AVVNLQYEGVTLPITGFGHLVPSSEDTSVLGIVYDSVAFPQHDGAGAASVRLTVMLGGAW
FGQSFGDPAAAAPAPPPPGGRVHQVGDTEGTRGGQRGSHRLTVCSPQACIPQYTLGHWQR
TERIGRFLAEQQLPLSLVGASYAGVSVNDCI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccccgcaggtctctgagctcggtctggagggtgacatcctgcccgtccctggggac
cacccggcctcccggaaccgcttcctctatgttggcggggcccttcacaagctgccctcg
ggactggggtacggacaacacccggtaccacgggccacccagcctgcccgaggcgctggc
cgccttcttgcgcccacgcggcgtcgagctgcgctgccacgcacccctgcgccgaactgc
cgggcgctgagcgtgcgctcctgcttccccgcgctcttcgaggccgagcggcgccggcga
tcggtgctgctggggctggcgctgccccgggggtccccttcccagtgtccccagtgtccc
cttcccggtgctccccaccgctctgcttccccccagctcaccctggatgatggcaccgtg
acagccgaccacgtcatcagcgccatcccagccgcagctctggctgaagtgctgccggcc
gaggcnnnnnnnnnnnnnnnnnnggcacgggagctgcgccacatcccggccgtgtcggtg
gccgtggtgaacctgcagtacgagggcgtcacgttgcccatcacgggcttcgggcacttg
gtcccctcctctgaggatacatccgtcctcggcatcgtctacgactcggtggcctttccc
cagcacgacggcgcgggggcggcctcggtgcggctgacggtgatgctgggaggcgcctgg
ttcgggcagagcttcggggacccggcggcggcggctccggcgccgccgcccccggggggg
cgtgtgcaccaggtgggtgacactgaggggacacgggggggacagcggggatcccacagg
ctcactgtctgctccccccaggcctgcatcccccagtacacactgggacactggcagcgc
acagagcggatcggccggttcctggcagagcaacaactgcccctcagcctggtcggagcc
tcctacgccggcgtctcggtcaacgactgcatc

DBGET integrated database retrieval system