KEGG   Columba livia (rock pigeon): 102094301Help
Entry
102094301         CDS       T02912                                 

Gene name
CHKB
Definition
(RefSeq) choline kinase beta
  KO
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
clv  Columba livia (rock pigeon)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102094301 (CHKB)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     102094301 (CHKB)
    2.7.1.82  ethanolamine kinase
     102094301 (CHKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 321 aa AA seqDB search
MFAILAERALGPRLYGVFPQGRLEGHLRDGLSPHPVLEDPLGSPRPGSGQTPHGASRGAG
GRAGSWGCSRGCASPQSRRLRTEDLRDPDISKEIAVKMSRFHGMVMPFNKEPKWLFGTME
WYLKQISELTFAEEAQLTKFNHLKTYNLQEEMKSLRELLEATPSPVVFCHNDVQEGNILL
LAGHEDSSDKLMLIDFEYSSYNYRGFDIGNHFCEWVYNYTHDSWPFFKASPENYPSRQQQ
LHFIRHYLSEDSGRRGDTTHEEQARIEEEMLTEINRFALASHFFWGLWSILQAKISTIKF
GYLDYAQSRFEAYFQHKAQCC
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccatcctggccgagcgggcgctggggccgcggctctacggggtgtttccgcag
gggcggctggaggggcatttacgggacggactgtctccccaccccgtcctggaggaccca
ctggggtcccctcgtcctggctcaggccagaccccccatggggcttctcgtggtgccggg
ggccgagccggctcctggggctgctcacgtggctgcgcgtccccccagagccggcgcctg
cggaccgaggacctgcgggaccccgacatctccaaggagatcgcggtgaagatgtcgcgg
ttccacggcatggtgatgcccttcaacaaggagcccaagtggctgtttgggaccatggag
tggtacctgaagcagatttcggagctcaccttcgctgaggaagcacagctgacgaagttc
aaccacctcaagacttacaacctgcaggaagagatgaagagcctcagggagctgctggag
gccaccccctcgcccgtcgtcttctgccacaatgacgtccaggaggggaacatcctgctg
ctggccgggcacgaggactcctccgacaagctgatgctcatcgacttcgagtacagcagc
tacaactaccggggcttcgacatcggcaaccacttctgcgagtgggtttacaactacacc
cacgactcctggcccttcttcaaggcgtccccggagaactaccccagccggcagcagcag
ctgcatttcatccggcactacctctcggaggactcggggcggcgtggggacaccacgcac
gaggagcaggcgcgcatcgaggaggagatgctcaccgagatcaaccggtttgccttggcc
tctcacttcttctggggcctgtggtccatcctgcaggccaagatctccaccatcaagttc
gggtacctggactatgcacagagccgcttcgaggcgtatttccagcacaaggcacagtgc
tgctga

DBGET integrated database retrieval system