KEGG   Columba livia (rock pigeon): 102095474Help
Entry
102095474         CDS       T02912                                 

Definition
UDP-glucuronosyltransferase 1-1-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
clv  Columba livia (rock pigeon)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102095474
   00053 Ascorbate and aldarate metabolism
    102095474
   00500 Starch and sucrose metabolism
    102095474
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102095474
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102095474
   00860 Porphyrin and chlorophyll metabolism
    102095474
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102095474
   00982 Drug metabolism - cytochrome P450
    102095474
   00983 Drug metabolism - other enzymes
    102095474
Enzymes [BR:clv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102095474
Glycosyltransferases [BR:clv01003]
 Others
  Hydrophobic molecule
   102095474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 587 aa AA seqDB search
MVPVLSAHARVTATLVLLLSMLSLAAGGKLLVVPVDGSHWLSMREVLDGLKQKGHEIVVV
APEITLHIKPTKNFVMKTYPVPFTQEELDRTFWRTGQNAFEEGSFLERFFKTRELVKNTS
ALFLSTCSHLLYNKELVTYLKESQFDAVFTDPFLPCGPILAEHLSLPSVFILQRLPCDLD
LQATQCPSPPSYVPRAFTDHTDRMNFLQRVRNLIYDIPNYFLCNFVFQPYATLASEFLQR
DVTVMDLLRQASIWLLRRDFVFQYPRPLMPNMVMVSGVTCAHKKLTQNEASDVLQREVTV
LELFSKASIWLMRYDFVFEYLCPIMPNIVYVGGINCAQRKSVSKEFEAIVNASGEHGIVV
FSLGSMVSEIPMKKAEEIADALGSVPQTVWFPSPNSSTAIQCSFQIHYMITFPFWSHPKA
RAFITHGGSHGIYEGICNAVPMVLMPLFGDQMDNAKQIESRGAGLTLNILEMTSQDISTA
LKAVINDKKYKENIKRLSELHLDRPIHPLDLAVHWVEFVMKHKGAPHLRPAAHDLNWIQY
HSLDVIAFLLAVVLLSLFISLKCCLFCCRRCCSKKGRARKPTKAKSH
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggtcccggtgctcagtgctcatgcacgagtcacagcgacgctggttctgctcctgtcc
atgctcagcttggctgctggtgggaagctgctggtggtgccggtggatgggagccattgg
ctcagcatgcgggaagtgttggatggtctgaagcagaagggacatgaaatagtcgtcgta
gcacctgaaatcactctccacataaagccaacaaagaattttgttatgaaaacgtaccca
gtgcctttcacgcaggaagagctggatcgcaccttctggagaactggccagaatgcgttt
gaagaaggatcttttctggaaagattttttaaaacacgtgaactagtgaaaaatacctct
gccttgttcctgtctacctgttcacacttactgtacaacaaagagcttgtcacatatctt
aaggagagtcagtttgatgctgtctttacagatcctttcctaccctgtgggccaatactg
gctgagcatctttcactcccttctgtgtttattttgcaacgcttaccatgtgatttagac
ttacaagccactcagtgtcccagtcccccttcttatgtccccagggcattcacagatcat
acagatcgcatgaactttctccagagggtgaggaacctaatatatgacatcccaaattat
tttctctgtaattttgtttttcaaccatacgcaacactggcttctgaattcctccagcgg
gatgtgactgtgatggatctcttacgccaggcttccatttggctcttgaggagagacttt
gtttttcagtatccgagaccattgatgcccaacatggtcatggttagtggagtaacttgt
gctcacaagaagctaacacagaacgaagcttctgatgttcttcaaagagaagtaacagta
ctggaactgtttagcaaagcatccatttggctgatgagatatgactttgtttttgagtac
ctgtgcccaataatgccaaatatagtctatgttggaggcatcaactgtgctcagagaaag
tcagtatcgaaggaatttgaagctattgtgaatgcctctggagaacatggcattgttgtc
ttctcgctgggctccatggtctctgagattcctatgaagaaagccgaagaaattgcagat
gccttgggctctgtccctcagacggtatggtttccctctcccaattccagcacagcaatt
caatgctcttttcaaatacactacatgattacctttcctttttggtctcaccctaaggct
cgtgcctttattacccacggaggctcacacggtatctacgagggtatatgcaacgcagtg
ccaatggtactaatgccgttatttggagaccagatggacaacgccaagcaaatagagtca
cggggagcaggactgacgctgaatatacttgaaatgacttcacaagacatatccactgcc
ctgaaagcggttattaatgataagaagtacaaagagaacatcaagcgcctctctgagctt
cacctcgacagacccatccacccgctggacctggccgtgcactgggtggagtttgtaatg
aaacacaaaggggccccacacctgcgccccgctgctcacgacttgaactggatccagtac
cactccctggacgtcatcgccttcctcctggccgtggtgctcctctccctcttcatttct
ctgaagtgctgcctgttctgctgccgcaggtgctgctctaagaagggaagagcaagaaag
ccaaccaaagcaaagtctcactag

DBGET integrated database retrieval system