KEGG   Columba livia (rock pigeon): 102095474Help
Entry
102095474         CDS       T02912                                 

Gene name
UGT1A1
Definition
(RefSeq) UDP-glucuronosyltransferase 1-1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00040  Pentose and glucuronate interconversions
clv00053  Ascorbate and aldarate metabolism
clv00140  Steroid hormone biosynthesis
clv00830  Retinol metabolism
clv00860  Porphyrin and chlorophyll metabolism
clv00980  Metabolism of xenobiotics by cytochrome P450
clv00982  Drug metabolism - cytochrome P450
clv00983  Drug metabolism - other enzymes
clv01100  Metabolic pathways
Module
clv_M00014  Glucuronate pathway (uronate pathway)
clv_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102095474 (UGT1A1)
   00053 Ascorbate and aldarate metabolism
    102095474 (UGT1A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102095474 (UGT1A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102095474 (UGT1A1)
   00860 Porphyrin and chlorophyll metabolism
    102095474 (UGT1A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102095474 (UGT1A1)
   00982 Drug metabolism - cytochrome P450
    102095474 (UGT1A1)
   00983 Drug metabolism - other enzymes
    102095474 (UGT1A1)
Enzymes [BR:clv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102095474 (UGT1A1)
Glycosyltransferases [BR:clv01003]
 Others
  Hydrophobic molecule
   102095474 (UGT1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 102095474
NCBI-ProteinID: XP_021136034
Position
Unknown
AA seq 536 aa AA seqDB search
MVPVLSAHARVTATLVLLLSMLSLAAGGKLLVVPVDGSHWLSMREVLDGLKQKGHEIVVV
APEITLHIKPTKNFVMKTYPVPFTQEELDRTFWRTGQNAFEEGSFLERFFKTRELVKNTS
ALFLSTCSHLLYNKELVTYLKESQFDAVFTDPFLPCGPILAEHLSLPSVFILQRLPCDLD
LQATQCPSPPSYVPRAFTDHTDRMNFLQRVRNLIYDIPNYFLCNFVFQPYATLASEFLQR
DVTVMDLLRQASIWLLRRDFVFQYPRPLMPNMVMVSGVTCAHKKLTQEFEAIVNASGEHG
IVVFSLGSMVSEIPMKKAEEIADALGSVPQTVWFPSPNSSTAIQWMCYCDLRNQKAKQVC
LSSTAHPKARAFITHGGSHGIYEGICNAVPMVLMPLFGDQMDNAKQIESRGAGLTLNILE
MTSQDISTALKAVINDKKYKENIKRLSELHLDRPIHPLDLAVHWVEFVMKHKGAPHLRPA
AHDLNWIQYHSLDVIAFLLAVVLLSLFISLKCCLFCCRRCCSKKGRARKPTKAKSH
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggtcccggtgctcagtgctcatgcacgagtcacagcgacgctggttctgctcctgtcc
atgctcagcttggctgctggtgggaagctgctggtggtgccggtggatgggagccattgg
ctcagcatgcgggaagtgttggatggtctgaagcagaagggacatgaaatagtcgtcgta
gcacctgaaatcactctccacataaagccaacaaagaattttgttatgaaaacgtaccca
gtgcctttcacgcaggaagagctggatcgcaccttctggagaactggccagaatgcgttt
gaagaaggatcttttctggaaagattttttaaaacacgtgaactagtgaaaaatacctct
gccttgttcctgtctacctgttcacacttactgtacaacaaagagcttgtcacatatctt
aaggagagtcagtttgatgctgtctttacagatcctttcctaccctgtgggccaatactg
gctgagcatctttcactcccttctgtgtttattttgcaacgcttaccatgtgatttagac
ttacaagccactcagtgtcccagtcccccttcttatgtccccagggcattcacagatcat
acagatcgcatgaactttctccagagggtgaggaacctaatatatgacatcccaaattat
tttctctgtaattttgtttttcaaccatacgcaacactggcttctgaattcctccagcgg
gatgtgactgtgatggatctcttacgccaggcttccatttggctcttgaggagagacttt
gtttttcagtatccgagaccattgatgcccaacatggtcatggttagtggagtaacttgt
gctcacaagaagctaacacaggaatttgaagctattgtgaatgcctctggagaacatggc
attgttgtcttctcgctgggctccatggtctctgagattcctatgaagaaagccgaagaa
attgcagatgccttgggctctgtccctcagacggtatggtttccctctcccaattccagc
acagcaattcaatggatgtgttactgtgacttaagaaatcaaaaagctaagcaagtctgt
ctttcctctacagctcaccctaaggctcgtgcctttattacccacggaggctcacacggt
atctacgagggtatatgcaacgcagtgccaatggtactaatgccgttatttggagaccag
atggacaacgccaagcaaatagagtcacggggagcaggactgacgctgaatatacttgaa
atgacttcacaagacatatccactgccctgaaagcggttattaatgataagaagtacaaa
gagaacatcaagcgcctctctgagcttcacctcgacagacccatccacccgctggacctg
gccgtgcactgggtggagtttgtaatgaaacacaaaggggccccacacctgcgccccgct
gctcacgacttgaactggatccagtaccactccctggacgtcatcgccttcctcctggcc
gtggtgctcctctccctcttcatttctctgaagtgctgcctgttctgctgccgcaggtgc
tgctctaagaagggaagagcaagaaagccaaccaaagcaaagtctcactag

DBGET integrated database retrieval system