KEGG   Columba livia (rock pigeon): 102095862Help
Entry
102095862         CDS       T02912                                 

Gene name
ART4
Definition
(RefSeq) ADP-ribosyltransferase 4 (Dombrock blood group)
  KO
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
clv  Columba livia (rock pigeon)
Brite
Enzymes [BR:clv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102095862 (ART4)
Cellular antigens [BR:clv04090]
 Proteins
  102095862 (ART4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:clv00537]
 Enzymes
  102095862 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 301 aa AA seqDB search
MSFTVSQVDSRMPVVLASLLLLISSQMLAVSHLMMDMSLHSFDDQYLGCREQMIEELEQG
DYFQEEIAANKDYLSLWKKAQEALLKSPVGLLREMHESHAIVLMAYTMNSSLHSELNWAT
STAGSSPENYRHNFSFKYFHFYLTTAIQIMKQWQSSKESMENPKCYRVHRGVKDLYIEAA
VGSRVRFGRFTSTSRLWNEAQRFGNETLFTVTTCLGAAVQGFSYHTSEKEVLIPPYEVFF
VKSFFRSQHGNRLHLHSVGNYSKYHCQLVEASRSKNSGSTALAFAVLPSVLGVFICLAHN
D
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttacagtgtctcaggtggactctaggatgccagtggtgctggccagccttctg
ttgctgatctcctcacaaatgctggctgtgtcccaccttatgatggatatgtctctgcat
tcctttgatgaccagtatctgggatgcagagagcagatgattgaagaactggaacaagga
gactatttccaagaggaaatagctgctaacaaggactatttgagtctctggaagaaggct
caggaggctttgttaaaaagccctgtaggtcttctgagggagatgcatgagagccatgcc
atagtcctcatggcttacaccatgaactcttccctgcactctgagctcaactgggccaca
tctacagcaggaagctctccagagaactacagacataacttcagtttcaaatattttcac
ttttacctaacgactgctatccagataatgaagcagtggcagagcagcaaggagagcatg
gagaatcctaagtgctaccgagtgcacaggggtgtaaaggacttatacatcgaggccgcg
gtaggcagcagagtgcgatttggtcgtttcacctccacctcccgcctctggaatgaagcc
cagaggtttgggaatgagactttgttcacagtgaccacttgcctgggagcagccgtgcaa
ggcttttcttaccacacatctgagaaggaagtcctcattcccccatatgaggtattcttt
gtcaaaagcttctttcggtcacagcatggtaaccggctgcatctgcattccgtggggaac
tacagcaagtaccactgccagcttgtggaagcttcaagaagcaagaacagtggttccact
gccctcgcctttgctgttcttcctagtgtacttggagttttcatctgcttggcccacaat
gactga

DBGET integrated database retrieval system