KEGG   Columba livia (rock pigeon): 102095920Help
Entry
102095920         CDS       T02912                                 

Definition
fatty acyl-CoA hydrolase precursor, medium chain-like
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:clv00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 556 aa AA seqDB search
MATGKDALLLSLILTVGVTALVATGHNAEQPEVETKYGRVRGYRFKVDAAERSVNVFLGL
PFAKPPVGPLRFSEPQPPEPWKGVRDATSYPPMCLQDKATGDWFSDIITNRKEKVHLQMA
EDCLYLNVYTPVATEKQELPVFVWIHGGGLFFGAGSSYDGSALAAFDNVVVITIQYRLGI
LGYFSTGDKHAPGNWGHLDQVAALQWIQENIRYFGGDPGSVTIAGESAGGISVSALVLSP
LAKGLFHKAISESGTASRLLFTDQPEEEAKRVAAASDCEKNSSAAIVECLREKTEEEIVQ
IAQKLASLYTKTCADGVFLPKSPQQLLSEKQIHPVPYIIGINNYEFGWLLPKLMQVSAYA
DGLDEDVARQLLQGLLATSIKGVTSEVVDRVYNEYIGNAANRIQVRDGFLDAVADAWFVF
PSIEVARYHRDAGNPVYFYEFQHRPSSATGVVPEFVKADHTDEIAFVFGKPFLAGNATEE
ENKLSRSVMRYWTNFARNGNPNGEGLVHWPQYDLDEGYLEIDLMQRASKKLKERKMEFWT
QLLKEMVDERREHSDL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggcaactggaaaggacgcgttgctgctgtcgctgattctgaccgtcggggtcacggcg
cttgtagctaccggacacaatgcagagcaaccagaagtggagaccaaatacgggagggtc
cgagggtaccgcttcaaagtggacgcagccgagaggagtgtgaatgtcttcctggggctt
ccttttgctaagccgccagttgggccactgaggttttctgaaccccagccacctgagcca
tggaaaggagtcagagatgccacttcctacccaccaatgtgtctacaggataaagcaaca
ggagattggttttcagatattattactaatagaaaagaaaaagttcatctccaaatggct
gaagattgcttatacctaaacgtgtatacacccgttgctacagaaaaacaggagctgcct
gtctttgtgtggatccatggaggtggattatttttcggagcaggttcatcctatgatggt
tcagcattagcggcctttgacaatgtggtggtgataacaattcagtacagattaggtatt
cttggatattttagcactggtgataagcacgcgccaggtaactgggggcatttggatcaa
gtagcagctcttcagtggattcaggaaaatatcagatatttcggaggagatccaggatcc
gtcactatcgctggagaatctgcaggaggaatcagtgtttctgctcttgtcttatctccc
ctggcaaagggtttgttccataaagccatttcagagagtggtactgcaagcaggcttttg
ttcactgaccagcctgaagaggaagcaaaaagagttgctgctgcctctgactgtgaaaaa
aacagttcagctgcgatcgttgaatgcttaagggaaaaaacagaagaagagatagtacaa
atagcacaaaaactggcttccctgtacaccaaaacatgtgcagatggggtatttcttcca
aagagtccccagcaattactatctgaaaaacagatccatccagtcccatatataatagga
ataaataactatgaatttgggtggctgcttcctaagttaatgcaagtttctgcgtatgca
gatggtctggatgaagatgttgcacgtcaacttttacagggcctcttagcaacgagtatt
aagggtgttacttctgaagttgttgatcgagtatacaatgaatacatagggaatgcagca
aaccgtattcaggtgcgagatggttttcttgatgcagttgcagatgcttggtttgttttt
ccatccattgaagtggccagataccacagagatgctggcaacccagtctacttttatgag
tttcagcatcgacccagttcagcgacaggggttgtaccagagtttgtaaaagcagatcat
acagatgagattgcctttgtgtttggaaagccattcttagctgggaatgctacagaagaa
gaaaataagcttagcagaagtgttatgagatactggactaactttgctagaaatggaaat
cccaacggagaaggattggtccattggcctcagtacgatctggatgaagggtacctggaa
atagacctcatgcaaagggcatcaaagaaactgaaagaacgcaaaatggagttttggaca
cagctcttaaaagaaatggtggatgaaaggagggaacacagtgatttataa

DBGET integrated database retrieval system