KEGG   Columba livia (rock pigeon): 102096285Help
Entry
102096285         CDS       T02912                                 

Gene name
ALPL
Definition
alkaline phosphatase, liver/bone/kidney
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102096285 (ALPL)
Enzymes [BR:clv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102096285 (ALPL)
Exosome [BR:clv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102096285 (ALPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 476 aa AA seqDB search
MKALLLLLLAPLCTPSLIPEREKDPEFWRRQAQHXFQRLNQNVAKNLILFLGDGMGVSTV
TAARILKGQLQNRKGEESLLEMDKFPYVALAKTYNTNAQVPDSAGTATAYLCGVKANEGT
VGVSAGVTRDRCNTTKGQEVTSILRWAKDSGKAVGIVTTTRVTHATPSAAYAHSANRDWY
SDGEMPPDALEGGCKDIARQLVENIPDIEVGGGQGHQEQGQGHGQPACPQVAKYVWHRRG
GRAXSRVDFLLGLFEPGDMVYELDRNNETDPSLTEMVAVAIRMLQKNPRGFFLLVEGGRI
DHGHHEGKAKQALHEAVELDRAIGLATRVTSPQDTLSVVTADHSHVFTFGGYTPRGNPIF
GLAPMQSDVDRKPFTSILYGNGPGYKIVAGERENVSAVDFAHADYQAQSAVPLRQETHGG
EDVAVFARGPMAHLLHGVHEQNYIPHAMAYAACIGANLPSGPHITLSQCHPILVSC
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctcttcttctcctcctcctcgccccgctctgcacgccatccctgatccccgag
agggagaaggaccctgagttctggcggcggcaggcgcagcatntttttcagcgcctcaac
cagaacgtggccaagaacctcatcctgttcctgggcgacgggatgggcgtctccaccgtc
acggccgcccgcatcctcaaggggcagctgcagaaccgcaagggcgaggagagtctcctg
gagatggacaagttcccgtacgtcgccttggccaagacctacaacaccaacgcgcaggtc
cccgacagtgcgggcacggccaccgcctacctgtgcggcgtcaaagccaacgaggggacc
gtgggcgtcagtgctggcgtcacccgcgaccgctgcaacaccaccaagggccaggaggtg
acgtccatcctgcgctgggccaaggacagcggcaaggcagtgggcattgtcaccaccacg
cgggtgacccacgcgacgcccagcgccgcctatgcccactcggccaaccgcgactggtac
tcggatggagagatgcccccagacgcgctggaaggcggctgcaaggacatcgcccggcag
ctggtggagaacatccccgacatcgaggtaggagggggacagggccaccaggaacaagga
cagggccatggacaacccgcctgtccgcaggtcgccaagtacgtgtggcaccggcggggg
gggcgcgctnncagccgtgttgacttcctcctgggtctcttcgagccgggtgacatggtg
tacgagctggacaggaataacgagacggacccgtccctcaccgagatggtggctgtggcc
atcaggatgctccagaaaaatccccgcgggtttttcctcctggttgaagggggccgcatc
gaccacgggcaccacgaggggaaggcgaagcaggcgctgcacgaggcggtggagctggac
cgggccatcgggctggccacccgtgtcacctccccgcaggacacgctcagcgtcgtcacc
gccgaccactcacacgtcttcaccttcggtggctacaccccccgtgggaaccccatcttt
ggtctggcccccatgcagagcgacgttgaccgcaagcccttcacctccatcctctacggc
aacggccccgggtacaaaatcgtggcgggcgagcgcgagaacgtctctgccgtggatttc
gcccacgcggactaccaggcgcagtcggcggtgccgctgcggcaggagacgcacggcggg
gaggacgtggcggtgttcgcgcgggggcccatggcgcacctgctgcacggcgtccacgag
cagaactacatcccgcacgccatggcctacgccgcctgcatcggcgccaacctgccttct
ggtccccacatcaccctgtcccagtgccaccccatcctggtgtcatgttag

DBGET integrated database retrieval system