KEGG   Columba livia (rock pigeon): 102096320Help
Entry
102096320         CDS       T02912                                 

Gene name
PADI1
Definition
peptidyl arginine deiminase, type I
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
clv  Columba livia (rock pigeon)
Brite
Enzymes [BR:clv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     102096320 (PADI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 657 aa AA seqDB search
MPQRHVVQMSTSHASYAVCVLGTEVFLDTRRCTPKDARSFDVYATSAVTVHIIHNPTTKP
MMNSRWPLDPDIEVAVTIGITSTAINDNKVKISYYGQEDNELSVAWLYLTCVDVSLDVDL
NRNGRVKSRGKDKAKWTWGPDGQGAVLLVNCDRDSPGAVGTDSGQVDIRTTADLQDMSLM
LLRTQGPSAIFAEYQVVLHVSESDAEKVRVFHALRTDSHPHYKPVLGPDKLSYVLDHVGS
GENIFYVEGLAFPDVGFSGLVSFSASLLENAPGTLIFTDTVVFRVAPWIMTPNTQQPLEV
FVCSIQQGSDSNEAFLEGLRALLKKANCKLTICSEVETRSDRWIQDELEFGYVEAPHKTF
PVVFDSPRNRGLKDFAFKKILGPDFGYVTRESPGKEVTSLDSFGNLDVSPPVTVRGKEYP
LGRILIGSPLPWATGRRMSKAVRAFLYAQKVQAPVEVYSEWLTVGHVDEFLTFVPAYDRK
GFRLLLASPNACYKLFKEMQWQGHGEATQLVGLKGIKRRSIDEILADASLKNDNRHVQRC
IDWNRDLLKQELGLSEQDIIDIPQLFILKGTHADAFFPNMVNMLVLGKHLGIPKPFGPKV
GGQCCLEQRVRELLEPLGLTCTFINDFFSYHLLSGDVHCGTNVRRKPFTFKWWHVMP
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaacgtcacgttgtgcagatgtccaccagccacgccagctacgccgtctgtgtg
ttgggtaccgaggtcttccttgatacacgccgatgtacacccaaagatgccagatccttc
gatgtctatgccacctccgcggtgaccgtccacatcatccacaaccccacaacaaaaccc
atgatgaactccaggtggcccctggatcctgatatagaggttgcagtgaccattggtatc
accagcacagccatcaatgacaataaggtgaagatttcatactacggccaggaagacaat
gagctttcggtggcttggttgtacctcacctgcgtagacgtgtccctggacgtggacttg
aaccgtaacggcagagtgaagagcagagggaaggacaaggccaagtggacgtggggtccg
gatggacaaggcgccgtgctgctggtcaactgcgaccgggacagccccggcgcggtgggg
acggacagcgggcaggtggacatacggaccaccgcagaccttcaggacatgtcgctcatg
ctgctgcggactcaaggtcccagcgctatctttgccgagtaccaggtggttctgcatgtc
tccgagtcggacgcagagaaagtgcgggttttccatgctctccggactgactcacacccc
cactacaaacccgtgttggggccggacaagctctcctacgtgctggaccacgttggtagt
ggagaaaacatcttctacgttgaagggttggctttccccgatgtgggcttctccgggttg
gtttctttcagcgccagcttgctggagaatgcgccgggcaccctgattttcacagatacg
gtggttttccgtgtggcaccatggataatgacgcccaacacacagcagcctctggaggtt
tttgtctgcagcatccagcagggttctgactccaatgaagcctttctggaaggactccgg
gccctgctgaagaaagccaactgcaagctgaccatctgctcagaggtggaaacccgcagt
gaccgctggatacaggacgagctggagtttggctacgtggaagcgccgcacaagaccttc
cctgttgtcttcgactcacccaggaaccgaggcttgaaggattttgctttcaaaaagatc
ctgggtcctgatttcggctacgtgacccgcgagtcccctgggaaagaagtcaccagcctc
gattcctttggcaacctggatgtcagcccgccagtgacggtgcgagggaaggagtatccc
ctgggccggatcctgatcggcagccccctgccttgggccaccggccggcgcatgtccaag
gccgtcagggcttttctttacgcccagaaagtgcaggcgccggtggaggtttactcggag
tggctgaccgtgggccacgtggatgaattcctcaccttcgtccctgcttacgacaggaag
ggtttccgtctcctcttggccagccccaacgcctgctacaagctcttcaaggagatgcag
tggcagggccacggtgaagccacacagcttgtcgggctgaagggcattaagaggagaagc
atcgatgagatcctggcagatgcatcgttgaaaaatgacaaccggcacgtgcagcgctgc
attgactggaaccgcgacctcctgaagcaggagctgggcctgagtgagcaggacatcatc
gacatccctcagctcttcatcctcaagggcactcacgcggatgccttcttcccaaacatg
gtgaacatgctggtgctgggcaaacacctgggcatccccaaaccctttggcccaaaggtg
ggtgggcagtgctgcctggagcagcgggtgcgggagctgctggagcccctgggactcacc
tgcaccttcatcaacgattttttctcctaccacctcctctccggtgacgtccactgcggc
accaacgtccggcgtaaacccttcaccttcaaatggtggcacgtgatgccctga

DBGET integrated database retrieval system