KEGG   Columba livia (rock pigeon): 102096407Help
Entry
102096407         CDS       T02912                                 

Gene name
GAD1, GAD67
Definition
(RefSeq) glutamate decarboxylase 1 (brain, 67kDa)
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
clv  Columba livia (rock pigeon)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    102096407 (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102096407 (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102096407 (GAD1)
   00430 Taurine and hypotaurine metabolism
    102096407 (GAD1)
Enzymes [BR:clv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102096407 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 590 aa AA seqDB search
MAASAPSSSNDAPDPTPTNLRPTTYDSWCGVAHGCTRKIGLKICGFLQRTNSLEDKGRIV
SSLKERQSSKNLLACENSEKESRFRRTETDFSNLYARDLLPAKNGEEQTMQFLLEVVDIL
LNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDNPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIIGWSNKDG
DGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAALGFG
TDNVILIKCNERGKIIPADLEAKILEAKQKGYIPLFVNATAGTTVYGAFDPIQEIADICE
KYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVREKGIL
QGCNQMCAGYLFQQDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCL
ELAEYLYTKIKNREEFEMVFEGEPEHTNVCFWYIPPSLRGMPDCDERREKLHRVAPKIKA
LMMESGTTMVGYQPQGDKVNFFRMVISNPAATKSDIDFLIEEIERLGQEL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatctgctccctcgtcctccaacgacgctccggaccccaccccaactaattta
cgacccacaacttacgactcgtggtgcggcgtggctcacgggtgcaccaggaagatcggg
ctgaagatatgcgggttcctgcaaaggaccaacagcttggaagacaagggccggatcgtc
agctccctgaaggaacgacagtcctccaagaacctgctggcatgcgagaacagcgagaag
gaatccaggttccggcgcacggagacagacttctccaatttgtatgccagagatttgcta
cccgccaagaatggcgaggagcagaccatgcagttcctgctggaggtcgtggacatcctt
ctcaactacgtgaggaaaacgtttgacagatctactaaagtgctggacttccaccaccca
caccagctcttggagggcatggagggctttaacctggagctctcagacaaccccgagtct
ctggagcagatcctggtggactgccgggacacgctgaaatacggagtgaggacaggtcac
cctcgctttttcaatcagctgtctacaggactggacatcattggcttggctggggagtgg
ctgacgtcaactgctaacacaaacatgtttacctatgaaattgcccctgtttttgtcctc
atggaacaaataacacttcgaaagatgagagagattattggatggtcaaataaagatggt
gatggaatattctcacctggaggagctatctccaacatgtacagcataatggctgcacgc
tacaagtatttccctgaagtcaaaaccaaaggcatggctgcagttcctaaactggttctc
tttacctcagaacatagtcactactcaataaagaaagctggtgctgcacttggatttgga
acagacaacgtgattttgataaaatgcaatgaaagaggcaaaataataccagctgatttg
gaggcaaaaattctggaagcaaaacaaaagggatacattcctctctttgtaaatgcaact
gcaggaacaacagtatatggagcctttgatccaatacaggagattgcagatatatgtgaa
aaatacaacctctggctccacgtagatgctgcctggggaggtggactcttaatgtcccga
aagcatcgtcataagttgaatggaatagaaagagccaactccgtcacctggaatccacac
aagatgatgggagtgttgttacagtgttctgctattcttgtccgggagaagggtatactt
caaggctgcaatcaaatgtgtgcaggctatctcttccaacaagacaaacagtatgatgta
tcctacgacaccggagataaggcaatacagtgtggtcgacatgtggacattttcaaattc
tggttgatgtggaaggcaaagggtacagtaggttttgaaaatcagatcaacaaatgcctg
gagctggcagaatatctctacactaaaataaaaaatagagaagaatttgagatggttttt
gaaggggagccagagcacacaaatgtctgtttttggtatattccgccaagtctcaggggt
atgccagactgtgatgagagaagagaaaagttacacagggtggcaccgaaaatcaaagca
ctgatgatggagtcaggtactaccatggttggatatcagcctcagggcgataaagtcaac
ttcttccgaatggtcatctcaaacccagcagcaactaagtctgacattgacttcctcatt
gaggagatagagaggttggggcaggagctgtag

DBGET integrated database retrieval system