KEGG   Columba livia (rock pigeon): 102096623Help
Entry
102096623         CDS       T02912                                 

Gene name
ALDH1L2
Definition
(RefSeq) mitochondrial 10-formyltetrahydrofolate dehydrogenase
  KO
K00289  formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    102096623 (ALDH1L2)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     102096623 (ALDH1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Formyl_trans_N Formyl_trans_C PP-binding DUF1487
Motif
Other DBs
NCBI-GeneID: 102096623
NCBI-ProteinID: XP_005507383
UniProt: A0A2I0MK61
Position
Unknown
AA seq 922 aa AA seqDB search
MRCFKNTCRTEGIKLEAYQHKLRLALIGQSIFGQEVYNKLRKEGHKVVGVFTVPDKNGQA
DPLALAAEKDGTPVFKFPRWRAKGKPIEEVVAAYKSVGAELNVLPFCTQFIPMDVIDCPK
HGSIIYHPSILPRHRGASAINWTLIQGDKKAGFTIFWADDGLDTGPILLQRECDVGQNDT
VDDLYNRFLFPEGVKAMVEAVHLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQPAAA
LHNWIRGHDKVPGAWATIDGQMVTFYGSSLLDASVPAGQELEIKGASRPGLVTKNGLVVF
GNDGKMVLVRNLKFEDGKMIPASKYFSADETTALELTEEEKKMAEDIRAIWKGILSNVAV
IEDSTDFFKSGASSMHVVRMLEEIKQKYSGLQLQNEDVYMATKFADFIQMSVRKFRGEDK
EEELVIDYVSKNVNNMTVNMPYQCFINGQFINADDGKTYDTINPADGSIIASVSSASLAD
VDKAVAAAKEAFENGEWGRMNAILRGNLMLQLLADLMEEHQEELATIESIDSGAVYTLAL
KTHVGMSVQTFRYFAGWCDKIQGATIPINQARPNHNLTFTKKEPIGVCAIVIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTSLKFAELSAKAGFPKGVINILPGSGGLVGQHLSE
HPDVRKVGFTGSTPTGKQIMKSAATNLKKVSLELGGKSPLIIFSDCELDRAVKMGMGAVY
FNKGENCIAAGRLFVEESIHDEFVSKVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQ
YCETGLKEGATLVCGGRQVRRPGFFMEPTVFTDVEDHMYIAQEESFGPVMVISKFKNGDV
DGVLRRANTTEYGLASGVFTKDISKALYISEKLEAGTVFINTYNKTDVAAPFGGFKQSGF
GKDLGEEALHEYLRTKAITVEY
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgcttcaaaaatacctgccgcacagaggggataaagctggaggcttaccaacat
aagctaaggctagcccttataggtcaaagtatatttggacaagaagtttataacaagctg
agaaaagagggccacaaagttgtgggagtgttcacagtgcctgacaagaatggacaagct
gatcctttggcactggcagcggagaaggacggcactcctgttttcaagttccccagatgg
agagcgaaaggcaagcctatcgaggaagtagttgcagcctacaaatcagttggagcagag
ctaaatgtccttcccttctgtacacagttcatccccatggatgttattgactgcccaaaa
catggctcaattatttaccacccatccatcctgccacgccaccgtggagcttccgcaatc
aactggactttaattcaaggagataagaaagcaggatttacaattttttgggctgatgat
ggcttggacactggaccaatacttctgcagcgagaatgtgatgttggacaaaatgacact
gtggacgacctgtacaaccgattcctttttccagaaggagtaaaggcgatggtggaagct
gtacatctaattgctgatggtaaggcccctcgtatacctcagcccgaagaaggggcaaca
tatgaagggatccagaaaaaggaaaatgcagagatctcctgggaccaacctgcagcagct
ttgcacaattggattcgagggcatgataaagtgcctggagcatgggcaacaatagatggc
cagatggttactttttatgggtcatcgttacttgatgcttcagtgcctgctggacaagaa
ctggaaataaaaggtgcttcaagacctggacttgtaaccaagaatggtctagtcgttttt
ggtaacgatgggaagatggtactagtgagaaatctgaagtttgaggatggaaaaatgatc
cctgcatctaaatacttctctgctgatgaaacaactgccctggaacttacagaagaggag
aaaaagatggcggaagatattagggctatttggaaaggaattttgagcaatgttgctgta
attgaggattccacagacttcttcaaatctggagcatcttctatgcatgttgtcagaatg
ctagaagagatcaaacagaaatacagtggacttcaactacagaatgaagatgtgtatatg
gccactaagtttgcagactttattcaaatgtctgtcagaaaattcagaggagaagacaaa
gaagaagagttagtcattgattatgtttcaaaaaatgtgaacaacatgactgtgaatatg
ccataccagtgtttcataaatgggcaatttataaatgctgatgatggaaaaacatacgac
actataaatccagcagatggatcaatcatagccagcgtgtcttctgcttcactggctgat
gttgacaaggcagtggcagcagcaaaggaggcatttgaaaatggtgaatggggaaggatg
aatgcaatattgaggggaaatttgatgctgcaattacttgcagacctgatggaggaacat
caagaagagttagcaacaatagagtctattgactcaggagctgtctacactttagctttg
aagacccatgttggaatgtctgtgcaaacattcagatactttgctggatggtgtgacaaa
attcagggtgctacaattccgattaaccaggcccggccaaaccataatctaacattcacc
aagaaagagccgataggtgtctgtgcaattgtaatcccctggaattacccgctgatgatg
cttgcatggaagagcgcagcttgcttggctgcaggcaacacactcgtactcaagccagct
caggtcacacctctgacttccttgaagtttgcagaactctcagctaaagctggatttcct
aagggtgttataaatattctgcctggttcaggtggattagtgggacagcacctgtctgag
catccagatgttcgcaaagttggattcaccggttcaacaccaactggtaaacagatcatg
aagagtgcagccactaacctgaagaaagtttctcttgaacttggtggcaaatcaccattg
atcatattcagtgactgtgaacttgacagagctgttaaaatgggtatgggagcagtatat
ttcaacaaaggagaaaactgcattgcagctggcaggctgtttgtggaagaatcaatccat
gatgaatttgttagtaaagtggtggaagaaataaaaaagatgaaaattggtgaccctctt
gatagatccacagatcatggtccacaaaatcacaaggctcatttggaaaagctgctacag
tattgtgaaactggactaaaagaaggagccactctagtgtgtggaggaagacaagtacgt
agaccaggtttcttcatggaacccactgtattcacagatgttgaagaccacatgtatatt
gcccaggaggagtcctttggtcccgtgatggtgatttctaagttcaaaaatggggatgtt
gatggagtgctgcgacgggcaaataccacagaatatggtttagcttcaggagttttcaca
aaagacataagcaaagctctctacatcagtgaaaagctagaagctgggacagtgtttatt
aacacatataacaaaactgacgtggcagcaccatttggtggatttaaacagtctggcttt
ggaaaagatttaggtgaagaagctcttcacgaatatctcagaaccaaggctatcactgtg
gaatattaa

DBGET integrated database retrieval system