KEGG   Columba livia (rock pigeon): 102096661Help
Entry
102096661         CDS       T02912                                 

Gene name
UCHL5
Definition
(RefSeq) LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase isozyme L5
  KO
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
clv  Columba livia (rock pigeon)
Brite
Enzymes [BR:clv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102096661 (UCHL5)
Peptidases [BR:clv01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102096661 (UCHL5)
Ubiquitin system [BR:clv04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    102096661 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 319 aa AA seqDB search
MXMGXLKRPVSFLISGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQ
DSRLDTIFFAKQVINNACATQAIVSVLLNCSHQDIHLGETLSEFKEFSQSFDAAMKGLAL
SNSEVIRQVHNSFARQQMFEFDAKSSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGA
CNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQRIAELQQQLAEEEPMDT
DHSSNMLSSIQSEVAKYQMLIEEENQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLI
PLVEKAKEKQNAKKVQEAK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtaaatggggtagttgaagagacctgtatcttttcttatttcaggttgtagaggagca
caagttgaagaaatatggagtttggaaccggagaactttgaaaaattgaagccagtacat
ggcctgattttcctcttcaaatggcagcctggagaggaaccagcaggttctgttgttcag
gattccagactggatacaatattttttgctaaacaggtaattaataatgcttgtgctact
caagccatagtaagtgtgctattaaattgctctcatcaagatatccatctgggagagact
ttgtcagaatttaaagaattttcacaaagttttgatgctgcgatgaaaggtttggcacta
agcaattcagaagtgattcggcaagttcataacagttttgccagacaacagatgtttgaa
tttgatgcaaagtcttcagcaaaagaagaagacgcatttcactttgtaagctatgttcct
gttaatggacggctatatgaactagatggcttaagggaagggccaattgatttaggtgca
tgcaatcaagatgactggataagtgctgtacggcctgtcatagagaaacgtatacaaaaa
tacagtgaaggtgagataaggtttaacttgatggctattgtatctgacagaaagatgata
tatgagcagaggattgcggaattacagcagcaacttgcagaggaggagcccatggataca
gatcatagtagtaatatgttaagttctatacaatcagaagttgcaaagtaccagatgtta
attgaagaagagaaccaaaaattaaaaagatataagattgaaaacattagaagaaaacat
aactacctgcctttcatcatggaattattaaagactctagcagagcaccaacagttaata
ccattagtagaaaaagcaaaagaaaaacagaatgccaagaaagttcaggaggccaagtga

DBGET integrated database retrieval system