KEGG   Columba livia (rock pigeon): 102097018Help
Entry
102097018         CDS       T02912                                 

Definition
(RefSeq) lipoprotein lipase-like
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
clv  Columba livia (rock pigeon)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102097018
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102097018
Enzymes [BR:clv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102097018
Exosome [BR:clv04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102097018
  Exosomal proteins of breast milk
   102097018
Glycosaminoglycan binding proteins [BR:clv00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   102097018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 486 aa AA seqDB search
MWRKAFLVALCLCLRWVAVLGGGAETETSFEGIESKFSLRTPAEPDEDVCYLIPGQVDSL
AQCNFNHTSKTFVVIHGWTVTGMYESWVPKLVDALYKREPDSNVIVVDWLVRAQQHYPVS
AAYTKLVGKDVATFIDWMEEQFNYPLNNVHLLGYSLGAHAAGIAGSLTKKKVNRITGLDP
AGPSFEYADAVTRLSPDDADFVDVLHTYTRGTPDRSIGIQKPVGHIDIYPNGGGFQPGCN
LGEALRLIAEKGFADVDQLVKCSHERSIHLFIDSLLYEEKPSMAYRCNTKEAFEKGLCLS
CRKNRCNNLGYKVNRVRTKRNTKMYLKTRAQMPYKVFHYQVKIHFFGKANTTKTNQPFLI
SLYGTLDESKDIAFTLPEVSSNKTFSFLIYTEVDIGDLLMLKLQWEKDTFFSWSDWWTPF
TFDIQRVRVKSGETQKKVVFCSRDGTSRLSKGEEAAIFVKCLEQPVNRKRGGAKKTSKEN
SAYESA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggaaagcgttcctagtcgccctctgcctctgtctgcgctgggtagctgttctc
ggtggcggcgcagaaactgagaccagtttcgagggaattgagagcaagttttccttacgg
acgcctgcagaaccagatgaggatgtctgctacctgattcctgggcaggttgacagcctg
gcacagtgcaacttcaatcataccagtaaaacctttgtggtgatccatgggtggacggtg
acaggaatgtatgaaagttgggtcccaaagctggtggatgctttgtacaagagggaacct
gattcaaatgtcattgtggtggactggctagttcgagctcagcagcactacccagtatct
gctgcatacactaagctggtgggaaaggatgttgctacgtttattgactggatggaggag
caattcaattatcctctcaacaatgttcacttgctggggtacagtcttggtgctcatgct
gctgggattgctgggagtctgactaagaagaaggtgaacagaattactgggctggatcca
gctggtccttcctttgagtatgccgatgctgtcacccgcctctccccggatgatgctgac
tttgtggatgtactacacacttacactcgaggtactccagatcgcagcattgggatccag
aagcctgttggacacattgatatttatcctaatggtggaggtttccagccaggttgcaac
ttgggagaagcactccgtctgattgctgaaaaaggctttgcagatgtggatcagctggtg
aaatgctcccatgaaagatccatccacctcttcattgactcactcctttatgaagaaaag
cccagcatggcctaccgctgcaacacaaaggaggcctttgagaagggtctttgcctgagc
tgccggaagaaccgctgcaacaatttgggttacaaggtcaacagagtgaggacgaagaga
aacaccaaaatgtatttgaagactcgtgctcagatgccatacaaagtctttcattaccag
gtcaagattcatttctttggaaaggctaatacgaccaagacaaaccagccattcctgatc
tctctctatggcactctagatgagagtaaggacattgcttttacactgcctgaagtgtct
tcaaacaagaccttctccttcctgatttacacagaagtggacattggtgacctgcttatg
ctgaagctgcagtgggagaaagataccttcttcagctggtcagactggtggactcctttt
acttttgacatccagagagtcagagtgaagtctggagaaactcagaagaaagtggtgttc
tgttctcgagatggcacctcacgtctcagtaaaggagaagaggcagcaatatttgtgaaa
tgtttggagcagcctgtcaacaggaagagaggaggtgccaagaaaacctccaaagaaaat
tctgcctatgaatctgcttaa

DBGET integrated database retrieval system