KEGG   Columba livia (rock pigeon): 102097093Help
Entry
102097093         CDS       T02912                                 

Definition
beta-galactoside alpha-2,6-sialyltransferase 1-like
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    102097093
   00514 Other types of O-glycan biosynthesis
    102097093
Enzymes [BR:clv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     102097093
Glycosyltransferases [BR:clv01003]
 Terminal extension
  Sialyltransferase
   102097093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 434 aa AA seqDB search
MKDQLLALCSVSHLDAPYTMVHINALKKLMCVLVVILVALTVCLWRETRRSYYVPFKTEN
DDLQVHRTSEKWTSLKSQGLFHEAVSELGHIPQTSFGNHNKVKGSTSGTAEKFKKAADSV
KVWDKDSSSRNLIPRLQKVRINYLSMNKYNVTYNGKRNTAKLSPEKLLCQLRDRVNVTMI
EGSDGPFDTSEWQQYIPGKSLNETVGRLGRCAVVSSAGSLKSSHLGQEIDSHDAVLRFNG
APIKGFQEDVGQKTTIRLVNSQLVTVEEQQFLREELYNTGILIVWDPAPYHAEIHEWYRK
PDYDFFESYKLYRSIHPEQPFYILNPKMQWQLWDILQENSLEPIQPNPPSSGMLGIVIMM
TLCDEVHVYEFLPSKRQTDICHYYQKFHDRACTMGAYHPLLFEKNLVKHINQGTDEDIYM
HGKVTLPGFRNVHC
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaccagctccttgccctgtgttcagtgtcccatctggatgcaccgtacactatg
gttcacatcaatgcgttgaaaaaattgatgtgtgttcttgtggtgatcctggtagcgctg
acggtgtgcctgtggagagagacgaggagaagctactatgttcctttcaagaccgagaac
gacgatttgcaggttcacaggacctcggaaaaatggacctcacttaaatcacagggcctt
ttccatgaagcagtcagtgaattgggtcacataccccaaacatcatttggtaaccacaac
aaagtaaaaggcagcacctctggaacagccgaaaagttcaagaaagcggcagactccgtg
aaggtgtgggataaggacagctcatccagaaatctcatacccaggctccagaaggtcaga
ataaattacttatccatgaacaagtacaatgtgacttacaacgggaagaggaacactgct
aaactcagcccagagaagctgctctgccagctacgggacagggtgaacgtgaccatgata
gaggggtcggatggtccttttgatacctctgaatggcagcaatacataccagggaaaagt
ctcaatgaaacagtgggccgcctgggtcgctgtgctgtcgtgtcctcggcagggtctctg
aaatcatctcatttgggacaagagatagacagtcacgatgccgtcttgcgattcaatggg
gctcctatcaaggggtttcaggaagatgtggggcaaaagacaacgattcgtcttgtgaac
tcccagcttgtaactgttgaggagcagcagttcctgagagaagagctatataacactgga
atcttaattgtctgggatccagcaccatatcatgcagaaattcatgagtggtacagaaaa
ccagactatgacttttttgaaagctataagttgtatcgtagtatacatccagagcagccc
ttctatatcctgaatccaaaaatgcagtggcaactctgggatatcctgcaggagaattca
ctggagcctattcagcctaatccaccatcatcaggaatgcttggcatcgtgatcatgatg
acgctctgtgatgaagtgcacgtgtatgaatttctcccttccaaacgacagacggacatt
tgccactattaccagaagtttcacgaccgtgcctgtaccatgggagcttaccaccccctc
ctgtttgagaaaaacttggtgaagcacataaaccagggcacagatgaggacatctatatg
catgggaaagttactttgcccggcttccgaaatgtgcattgctag

DBGET integrated database retrieval system