KEGG   Columba livia (rock pigeon): 102097093Help
Entry
102097093         CDS       T02912                                 

Definition
beta-galactoside alpha-2,6-sialyltransferase 1-like
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:clv00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:clv00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 434 aa AA seqDB search
MKDQLLALCSVSHLDAPYTMVHINALKKLMCVLVVILVALTVCLWRETRRSYYVPFKTEN
DDLQVHRTSEKWTSLKSQGLFHEAVSELGHIPQTSFGNHNKVKGSTSGTAEKFKKAADSV
KVWDKDSSSRNLIPRLQKVRINYLSMNKYNVTYNGKRNTAKLSPEKLLCQLRDRVNVTMI
EGSDGPFDTSEWQQYIPGKSLNETVGRLGRCAVVSSAGSLKSSHLGQEIDSHDAVLRFNG
APIKGFQEDVGQKTTIRLVNSQLVTVEEQQFLREELYNTGILIVWDPAPYHAEIHEWYRK
PDYDFFESYKLYRSIHPEQPFYILNPKMQWQLWDILQENSLEPIQPNPPSSGMLGIVIMM
TLCDEVHVYEFLPSKRQTDICHYYQKFHDRACTMGAYHPLLFEKNLVKHINQGTDEDIYM
HGKVTLPGFRNVHC
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaccagctccttgccctgtgttcagtgtcccatctggatgcaccgtacactatg
gttcacatcaatgcgttgaaaaaattgatgtgtgttcttgtggtgatcctggtagcgctg
acggtgtgcctgtggagagagacgaggagaagctactatgttcctttcaagaccgagaac
gacgatttgcaggttcacaggacctcggaaaaatggacctcacttaaatcacagggcctt
ttccatgaagcagtcagtgaattgggtcacataccccaaacatcatttggtaaccacaac
aaagtaaaaggcagcacctctggaacagccgaaaagttcaagaaagcggcagactccgtg
aaggtgtgggataaggacagctcatccagaaatctcatacccaggctccagaaggtcaga
ataaattacttatccatgaacaagtacaatgtgacttacaacgggaagaggaacactgct
aaactcagcccagagaagctgctctgccagctacgggacagggtgaacgtgaccatgata
gaggggtcggatggtccttttgatacctctgaatggcagcaatacataccagggaaaagt
ctcaatgaaacagtgggccgcctgggtcgctgtgctgtcgtgtcctcggcagggtctctg
aaatcatctcatttgggacaagagatagacagtcacgatgccgtcttgcgattcaatggg
gctcctatcaaggggtttcaggaagatgtggggcaaaagacaacgattcgtcttgtgaac
tcccagcttgtaactgttgaggagcagcagttcctgagagaagagctatataacactgga
atcttaattgtctgggatccagcaccatatcatgcagaaattcatgagtggtacagaaaa
ccagactatgacttttttgaaagctataagttgtatcgtagtatacatccagagcagccc
ttctatatcctgaatccaaaaatgcagtggcaactctgggatatcctgcaggagaattca
ctggagcctattcagcctaatccaccatcatcaggaatgcttggcatcgtgatcatgatg
acgctctgtgatgaagtgcacgtgtatgaatttctcccttccaaacgacagacggacatt
tgccactattaccagaagtttcacgaccgtgcctgtaccatgggagcttaccaccccctc
ctgtttgagaaaaacttggtgaagcacataaaccagggcacagatgaggacatctatatg
catgggaaagttactttgcccggcttccgaaatgtgcattgctag

DBGET integrated database retrieval system