KEGG   Columba livia (rock pigeon): 102097674Help
Entry
102097674         CDS       T02912                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    102097674 (DBH)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     102097674 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 616 aa AA seqDB search
MGKARRMGAVLPSMQTSGCKPCPSFKLREVASMYFTMIAVFLVILVVALQGSAPRKSDFP
XXXXXXPXGLLELSWNISYPKQTVYFQLLIRDLKSGLLFGMSDRGEFENADLVVLWSDGH
NSYFGDAWSDAKGQLHMDSQQDYQLLGAWRATEGLYLLFRRAFSTCDPKDYLIEDGTVHL
IYGILEKPVHSLQAINISAIQRGLQRVQLLKPNITVPELPSDRKTMELTAPNIVIPSEMT
TYWCYMAELPAGFPKHHIIMYEPVITAGNEAIVHHMEVFQCAAEFDSFPLYNGPCDSKMK
PERLSYCRHVLAAWAMGAQAFYYPEEAGLAFGGPGSSRYLRLEIHYHNPLMFKGRRDSSG
IRLYYTSTLRRYDAGIMELGLVYTPVMAIPPGEDAFILTGYCTDKCTQLALPAAGIHIFA
SQLHTHLAGRKVVTVLSRDGRERQVVNADRHYSPHFQEIRMLKEVVAVFPGDELITTCTY
NTEDRSRATVGGFGILEEMCVNYVHYYPQTQLELCKSAVDPGYLHRYFNLVNRFNDEEVC
TCPQVSVPQQFFSVPWNTFNRDVLKSLYSFAPISMHCNKSSAVRFPGEWEKQPLPPAPGP
RPAAPVPLDLGKLRRD
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagccagacgcatgggtgctgttctccccagcatgcagacctcggggtgcaag
ccctgccccagctttaagctgcgggaggtggcatccatgtacttcaccatgatcgcggtg
ttcctggtcatcttggtggtggccctgcagggctcggcaccccgcaagagtgattttccn
nnnnnnnnnnnnnnnnnncccnagggtctgctcgagctctcctggaacatcagctacccc
aagcaaaccgtgtatttccagctcctcatcagggatctgaagtctgggctcctcttcggg
atgtcggacaggggcgagttcgagaatgcggacctggttgtgctctggagcgatgggcac
aattcctatttcggggatgcctggagcgatgccaaggggcagctccacatggactcacag
caggactaccagctcctcggggcttggagggctacggaggggctctacctcctcttcaga
agagccttcagcacctgtgaccccaaggactaccttattgaggatggcaccgtgcacctt
atctacgggatcctggagaaaccagtccattctcttcaagccatcaacatctctgctatc
cagaggggactgcagagggtgcagctgctaaagcccaacatcaccgtccctgaactgccc
agtgacaggaagaccatggagttaacggcccccaacattgtcattcccagcgagatgaca
acctactggtgttacatggcagagctcccagctggcttccccaaacatcacattatcatg
tacgagccagtgatcacggcgggcaacgaggccattgtccaccacatggaagtcttccag
tgcgctgcagagttcgacagttttcccctttacaacggaccttgtgactccaagatgaag
ccagagcggctcagttactgccggcacgtgcttgcagcgtgggccatgggagcacaggct
ttctactaccctgaagaagcaggtcttgcctttggtggcccaggctcctccagatactta
cgccttgagattcattaccacaaccccctgatgttcaaaggtcgccgcgactcctcgggg
atccgtctctactacacgtccaccctgcgacgctatgatgccggcatcatggagctgggc
ttggtctacacaccggtgatggccattcccccgggcgaggatgccttcatcctcacggga
tattgcaccgacaaatgcacccagctggctctgcctgctgccggcatccacatcttcgcc
tcccagctccacactcacctggcaggaagaaaagtggtgacggtgctgtcccgggacggg
agagagcggcaggttgtcaacgccgacaggcactacagccctcacttccaggagatccgc
atgctgaaggaggtggttgcagtttttccaggcgatgagctcatcacgacctgcacatac
aacacggaggaccggagccgagccaccgtggggggctttggcatcctggaagagatgtgt
gtgaactacgtgcactactacccccagacccagctggagctgtgcaaaagtgctgtggat
ccgggctacctgcaccgatacttcaacctcgtgaacaggtttaacgacgaggaggtctgc
acctgcccacaggtctctgtcccacagcagtttttctctgtcccctggaacacattcaac
agagacgtcctgaaatccctctacagctttgctcccatctccatgcactgcaacaaatcc
tcagccgtccgcttcccgggcgagtgggagaagcagccgcttccccccgccccggggcct
cggccggccgcccccgtccccctcgacctgggcaaactcaggagggactga

DBGET integrated database retrieval system