KEGG   Columba livia (rock pigeon): 102097697Help
Entry
102097697         CDS       T02912                                 

Definition
erythroblast NAD(P)(+)--arginine ADP-ribosyltransferase-like
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
clv  Columba livia (rock pigeon)
Brite
Enzymes [BR:clv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102097697
Cellular antigens [BR:clv04090]
 Proteins
  102097697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 232 aa AA seqDB search
MEYLVLGLALLAGTLTAGSPLHRRDLSPIKEVALDMAPNSFDDQYRGCGRMMEEELQELN
RTEFTNNSIYANAWTIAAAEWRNRRGRGGIRFTARSWQSIRFGHFTSASLRYESTQNFGQ
DTFFSMETCYGVPIRDFSSFPEEEEVLIPPFESFEVTSVTRNGSRALIQLRSQAANSTYN
CEFVKEKRCRSRPCVFSTGWSIPRDPPHLWGLLLAATALAAAGGPCPATAPW
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggagtatctggtgctgggcttggcgctgctggccgggacattgactgccggcagcccc
ctgcaccggcgagacctcagccctatcaaggaggtggcactggacatggcccccaactcc
ttcgacgaccagtaccggggctgcggccgcatgatggaggaggagctgcaggagctcaac
cgcaccgagttcaccaacaacagcatctatgccaatgcctggaccatcgctgctgccgaa
tggcggaaccggcggggccgcggcggcatccgcttcaccgcccgcagctggcagtccatc
cgcttcggccacttcacctccgcctccctcaggtacgagagcacccagaacttcggccag
gacaccttcttctccatggagacctgctatggcgtccccatcagggacttctcctccttc
cccgaggaggaggaggtcctcatcccacccttcgagagctttgaggtcaccagtgtcacc
cgcaacgggagcagagccctcatccagctccgctcccaggctgcaaacagcacctacaac
tgcgagttcgtgaaagagaagagatgccggagccggccgtgcgtcttcagcacaggctgg
agcatccccagggaccccccacatctctgggggctcctcctggcagccacggccctggca
gctgctgggggtccctgccctgccactgccccatggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system