KEGG   Columba livia (rock pigeon): 102097908Help
Entry
102097908         CDS       T02912                                 

Gene name
JOSD1
Definition
Josephin domain containing 1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
clv  Columba livia (rock pigeon)
Brite
Enzymes [BR:clv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102097908 (JOSD1)
Peptidases [BR:clv01002]
 Cysteine Peptidases
  Family C86
   102097908 (JOSD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 202 aa AA seqDB search
MSCVPWKGDKTKSEPPEPPQPPPLHIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVNVIALSNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGTYYNLDSKLKVPEWIGGESELRKFLKHQLRGK
NCELLLVVPEEVEAHQSWRADV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcgtgccatggaaaggtgacaagaccaaatcggaaccgccagagccacctcag
ccaccaccactgcatatttaccatgagaagcagcgtagggagctgtgtgccctgcatgcc
ctcaacaatgtcttccaggacagcaatgccttcactagggaaaccctgcaggagattttc
cagaggctgtctcccaacaccatggtgacgccccacaagaagagcatgttgggaaacgga
aactatgatgtgaacgtgatcatggcagcgcttcagaccaaaggctacgaggcagtttgg
tgggacaagcgcagggatgttaacgtcatcgccctgtccaacgtgatgggcttcatcatg
aatctgccatccagcctctgctggggccccttgaagctccccctcaagcgacagcactgg
atctgcgtccgggaggtgggaggcacctactacaaccttgactccaaactcaaggtgccc
gagtggattgggggtgaaagtgagctcaggaaatttttgaaacaccagctgagaggaaag
aactgtgaactcctgctggtggtgccagaggaggtggaagcacatcagagctggagagct
gacgtgtga

DBGET integrated database retrieval system