KEGG   Columba livia (rock pigeon): 102098656Help
Entry
102098656         CDS       T02912                                 

Gene name
RBKS
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
clv  Columba livia (rock pigeon)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    102098656 (RBKS)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     102098656 (RBKS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 298 aa AA seqDB search
MTDLVSLTTRLPRAGETILGHKFFIGFGGKGANQCVQSARLGAKTSLICKVGKDSFGNDY
VENLKKNGISTAFVGQTTDAATGTASIIVNSEGQNVIVIVPGANLLLNSEDLKRASDVIC
NAKVVVCQLEITPAVSLEALKMAHASGVKTLFNPAPALADLDPQFYTYSDIFCCNETEAE
ILTGIPVGNLEDAEKVGRMLLQRGCKLVIVTLGAEGCMMISVEEPIPKHVPAGKVRAVDT
TGAGDSFMGALAFYLAYYPKLPMEEMIRKSNCVASVSVQASGTQSSYPYRKDLPQDLF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctggtcagccttactacacgattgccaagagctggtgaaactatccttgga
cataagtttttcattggttttggtgggaaaggagccaaccaatgtgtccagtctgctcga
cttggggccaagacctcgctgatctgcaaggttgggaaggattcctttggcaatgattat
gttgaaaatttgaagaagaatggtatttctacagcatttgtaggtcagactacagatgct
gctactggaacggcttcaataattgtcaacagtgaaggacagaatgttattgtcatagtc
ccaggagccaacctgcttttaaattctgaagacctgaagagggcttctgatgtcatctgt
aacgccaaagtggttgtttgccagctagaaataacccctgctgtttctcttgaagctctg
aaaatggcacatgccagtggagtaaagactttatttaatccagctccagcccttgctgac
ctagatccacagttttatacctattctgacatcttctgctgcaatgaaactgaggcagaa
attctaacgggcatcccagttggcaatcttgaagatgctgaaaaggtgggacgcatgctg
ttacaaagagggtgtaagctcgtaattgttactcttggagcagaaggctgcatgatgata
tcagtagaagaacccattccaaagcacgttcctgctgggaaggtcagggctgtggacact
acgggagctggagacagttttatgggagcactggccttctacctggcttactatcccaag
ttacccatggaggaaatgatcaggaagtcgaactgcgttgcatcagtgagcgtccaggca
tcagggacacaatcttcatatccttacaggaaggacttgcctcaggaccttttctaa

DBGET integrated database retrieval system