KEGG   Columba livia (rock pigeon): 102099031Help
Entry
102099031         CDS       T02912                                 

Gene name
GBA2
Definition
glucosidase, beta (bile acid) 2
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
clv  Columba livia (rock pigeon)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102099031 (GBA2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102099031 (GBA2)
Enzymes [BR:clv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102099031 (GBA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 820 aa AA seqDB search
MQLKRPLGEKLSDGHCPAVLLVCEQRYFRWWLKKTRIEKKPAFIDLLCAVPLQQIYGCPL
GGIGGGTITRGWRGEFCRWQLNPGIYHYETVIADQFTVCLRCKGQTVYQQVLSVERPSTL
QGWNWGYCGHYAFYHALYPRAWMVYELPGQNVVLTCRQISPVIPHDYKDSSLPVGVFIWE
VENGRDEDVDVSIMFSLQNGTGTKEDRSGGHWNEPFTFEKEGERVAGVLLHHCTHVNPFT
FAISAREKAGVVVTHLTAFNPAGSGREVWQDLLQDGQLDSSDGKSNPTEKGEVTAAAVCA
SCRVPAQGHRTLELALAWDMPCIHFGSKEKLHLRRYTRFFGSGGDAAPALSHHALTHYEE
WERKIEAWQKPILENSQLPSWYKSALFNELYFLTDGGTIWMELPPDCCTEDLQGPAGSGL
SNLLPVLQEYGRFAYLEGQEYRMYNTYDVHFYASFALIMLWPKLQISLQYDIAVAVVNED
VQPRQYLMGGQTAPVKTKNVVPHDIGDPADEPWQRVNAYLIHDTANWKDLNLKFVLQVYR
DYYLTHDSLYLRDMWPVCQAVMESELKFDMDNDGLIENGGFADQTYDAWVVNGASAYCGG
LWLAAVCMMCKMAEVLGDAEIQQKYMDILRKGKETFERLLWNGKYYNYDSSGSNTSSSIM
SDQCAGQWFLGACDLDHGEFEVFPKSHVVSALKTIFEKNVMGFAGGTMGAVNGMRPSGVP
DTSSVQSNEVWVGVVYALAATMIQEGLVEEGFRTAEGCYRTVWEQLGMAFQTPEAYREKK
VYRSLAYMRPLSIWSMQLALERRATRAPAPAQPSQVPLHP
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgaaaaggcctttgggtgagaaattatctgatgggcactgcccggctgtgctt
ctggtgtgtgagcagagatacttcagatggtggttgaagaagacccgcatagagaagaaa
cctgccttcattgacctcttgtgtgctgttcctctgcagcagatctatgggtgcccgctg
ggtgggatcggaggaggcaccatcacccgtggctggcggggtgagttctgccgctggcag
ctgaaccctggcatttatcactacgaaacagtcattgctgaccagttcacggtgtgcctg
cgttgcaaggggcagacggtttaccagcaggtcctgtctgtggagagacccagcactctg
cagggatggaactggggctactgcggtcactacgccttctaccatgccctgtacccccgt
gcctggatggtctacgagctcccagggcaaaacgtggtgcttacttgccgccagatctct
cctgttatcccccatgactacaaggactccagcttgccagtgggagtgttcatctgggag
gtggaaaatggaagggatgaggatgtggatgtctccatcatgttcagcctgcagaatggc
acgggaacaaaggaggacagaagtggagggcactggaatgagcccttcaccttcgagaag
gagggtgagcgggttgctggagtcctgctgcaccactgcactcatgtcaaccctttcacc
tttgccatctctgcccgggagaaggctggtgtggtagtcacccacctcacagcgttcaat
ccagcagggtcgggcagagaggtgtggcaggatctcctgcaggacggacagctggattct
tctgatggtaaaagcaacccaacagagaagggggaggtgacagcagccgcagtgtgtgcc
agctgcagagtgcccgcccagggccacagaacgctagagctggcactggcttgggacatg
ccttgtatccactttggctccaaggaaaagctgcacttgaggcggtacacccgttttttt
ggcagtggaggtgatgctgctcctgccctgtcacatcacgccctgacccactacgaggag
tgggagaggaagattgaagcatggcagaagcccatcctggagaacagccagctgccttcc
tggtacaagtcggccctcttcaatgagctgtacttcctgacggatgggggcaccatctgg
atggagttgcccccagactgctgcactgaggacctgcaggggccagcggggtctggcctc
tccaacctcctccctgtcctgcaggagtatggaaggtttgcttatttggaaggccaggag
taccggatgtataacacctacgatgtccacttctatgcctcctttgctctcatcatgctg
tggcccaagctgcagatcagcctgcagtatgacattgctgtcgcagtggtgaatgaggat
gtccagccccggcagtacttaatgggtggtcagacagccccggtgaagacaaagaatgtg
gtgccacatgacattggggacccagctgacgagccgtggcagcgtgtcaatgcctacctg
atacacgacacggccaactggaaggacctcaacctgaagtttgtactgcaggtgtaccgt
gactactacctgacacacgactccctgtacttacgggacatgtggccagtctgccaggct
gtgatggagtcagagctgaaatttgatatggataatgatgggctcatcgaaaatggtggc
tttgctgaccagacatatgacgcatgggtggtaaatggagccagcgcgtactgtggtggg
ctgtggctggcagccgtctgcatgatgtgcaagatggcagaagtgcttggggatgcagaa
atccagcagaaatacatggatatcctgaggaagggcaaggagacatttgagaggctgctc
tggaatggtaaatactacaactatgacagtagtgggagcaacacctccagtagcattatg
tcagaccagtgtgctgggcagtggtttcttggggcctgtgatctggatcacggggagttt
gaggttttccccaagagtcatgttgtcagtgcactcaagaccatctttgagaagaatgtc
atgggctttgctggtggcacaatgggagcggtgaatggcatgagacccagtggggtgcct
gacacctccagcgtgcagtccaatgaggtgtgggttggcgttgtctatgccttggctgcc
accatgatccaggaggggctggtggaggaaggctttcgcacagctgagggctgctacaga
acagtttgggaacagctgggcatggctttccagacaccagaggcctatcgggagaagaaa
gtctaccgctccctggcttacatgcgacccctcagcatctggagcatgcagttggccctg
gagcgcagagccacccgggcacccgcacctgcacagccctcccaggtccccctccaccca
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system