KEGG   Cellulophaga lytica DSM 7489: Celly_0065Help
Entry
Celly_0065        CDS       T01434                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
cly00511  Other glycan degradation
cly00520  Amino sugar and nucleotide sugar metabolism
cly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Celly_0065
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Celly_0065
Enzymes [BR:cly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Celly_0065
Chaperones and folding catalysts [BR:cly03110]
 Intramolecular chaperones
  Others
   Celly_0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2
Motif
Other DBs
NCBI-ProteinID: ADY27900
JGI: Celly_0065
UniProt: F0RFF8
Position
56534..58147
Genome map
AA seq 537 aa AA seqDB search
MKNSILFRTLLTLIGIFLIVACQEKRVIINYPTTDLSAENMVPLPLKITPTNSAFGLDKN
TAIYTSNDSGFEQVGSFLSNKISTKINLEVPVNTVNNIEKAKIIYINKTDSLELKSKEAY
QMYITQDSIIINAKTAAGAFRGIQTLRQIIPEESNDTLTTHKMWLVPSGKILDQPNYEYR
GAMLDVARHFFSVGDVKKYLDVLAYYKFNALHLHLTDDQGWRIEIKSWPKLTEIGASTEV
GGGPGGFYTQEDFKEIVRYATERHITIVPEIDMPGHTNAATVAYPQLNGNGKTPKVYTGM
RVGFSTFDTNKDIVYAFVDDVVREISAISPGLYFHLGGDESHVTKKKDFKKFILKVSKIV
ESHGKTPIGWDEIATTDISSNAVAQFWRSEKNANLALDKGMKIILSPAKKAYLDMKYDTL
SKHGLTWATYIPVDSAYIWTPETFVKNLPKAQVLGIEAPLWSETISNIEELEYLAFPRII
GYSELNWTIKENRNWENYKNRLANQAPYLDRMNVKYYPTKLIDWKKSKHTYKYIEKD
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattctatcttatttagaacactattaacccttattggcatttttttaatagtt
gcttgccaagaaaaaagagtaattattaactacccaactacagatttatctgcagaaaat
atggttcccttgccattaaaaataactcccaccaatagtgcatttggtttagacaaaaac
actgcaatttatacctctaatgactctggttttgagcaagtaggttcttttttatctaac
aaaattagcactaaaattaatttagaagttcctgtaaatactgttaataatattgaaaaa
gctaaaattatatacataaataaaacagatagtttggaacttaaaagtaaggaagcttac
caaatgtatattacgcaagattctattattataaatgctaaaacagctgctggtgcattt
agaggcatacaaacattaagacaaattataccagaagaaagtaatgatacgcttactacc
cataaaatgtggcttgtacctagcggaaaaatactagatcaacctaattacgagtacaga
ggtgctatgttagatgtagccagacatttttttagtgttggtgacgtaaaaaaataccta
gatgtattagcatattataaatttaatgccctgcacttacacttaactgatgaccaaggt
tggagaatagaaattaaatcttggccaaaactaacagaaattggagctagcacagaagtt
ggcggtggccctggagggttttatacccaagaagattttaaagaaattgtacgttatgca
accgaaaggcatattacaattgtaccagagatagatatgcccggacatactaatgctgca
acagttgcatatccgcaattaaacggaaacggaaaaacgcctaaagtttataccggtatg
cgtgtaggctttagcacttttgatacaaataaagatattgtttatgcctttgtagatgat
gttgtaagagaaatttctgccatttctcctggcctttattttcatttaggaggagatgaa
agccacgttacaaaaaagaaggattttaaaaaatttattttaaaagtatctaaaattgta
gaaagtcacggaaaaactccaattggttgggatgaaattgctactacagatataagtagc
aatgctgttgctcaattttggagaagcgaaaaaaatgcaaacttagcgctagataagggt
atgaagattattttgtctcccgctaaaaaagcttatttagatatgaaatatgataccttg
tctaaacacggtttaacttgggcaacttatatacctgtagattctgcttatatctggaca
ccagaaacctttgtaaaaaacttacctaaagcacaggtattaggtatagaagctccttta
tggtccgagactataagcaatattgaagagctagaatatttagcttttcctagaattatt
ggctactctgagcttaactggaccataaaagaaaacagaaattgggaaaattataaaaat
agattagctaaccaagcaccttatttagaccgtatgaatgttaaatactacccaactaaa
cttatagactggaaaaaaagcaaacacacatataaatacattgaaaaagattaa

DBGET integrated database retrieval system