KEGG   Cellulophaga lytica DSM 7489: Celly_0286Help
Entry
Celly_0286        CDS       T01434                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
cly00260  Glycine, serine and threonine metabolism
cly00750  Vitamin B6 metabolism
cly01100  Metabolic pathways
cly01110  Biosynthesis of secondary metabolites
cly01120  Microbial metabolism in diverse environments
cly01230  Biosynthesis of amino acids
Module
cly_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celly_0286
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Celly_0286
Enzymes [BR:cly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Celly_0286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ADY28121
JGI: Celly_0286
UniProt: F0RH83
Position
297707..299002
Genome map
AA seq 431 aa AA seqDB search
MNYYSLNKKAPNTTFKNAVIKGLAPDKGLYFPESITPLPADFFKNLDNLSNSEIAFTAIK
QFVSPEIPEDVLKTIVEETLSFNFPVVKLDENVSTLELFHGPTMAFKDVGARFMARCLGY
FNKNNTNEVTVLVATSGDTGGAVANGFLGVKGVNVVILYPSGKVSDIQEKQLTTLGQNIT
ALEVDGVFDDCQDMVKRAFLDEELTSKMQLTSANSINVARWLPQLFYFIFAYKQLHNTHK
KIVFSVPSGNFGNICAGMMAQQLGLPIHHFIASNNKNNVVTTYLKTEEYNPKPSVQTISN
AMDVGNPSNFIRIQEIHKNDFGALTENLSSYSFSDEETKEALAHIYKTYNYVADPHGAVG
YLGCKAYLKNNNDVHCVFLETAHPTKFLDVVEDVIKEKQPLPEQIQEVMHKTKVATKIGS
YNDLKSYLLNN
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaattactactcgttaaacaaaaaagcgcctaatactacatttaaaaatgcagttata
aaaggcttggcaccagataaaggattgtactttcctgaaagtataacacctttacctgca
gatttctttaaaaatttagacaatttatctaattcagaaattgcttttacagccattaaa
caatttgtttctcctgaaattccagaggatgttctaaaaaccattgtagaggaaacatta
tcctttaattttcctgtggttaagttagatgagaatgtgtctacattagagctttttcac
ggaccaacaatggcatttaaagatgttggggcacgttttatggctcgttgtcttggctat
tttaataaaaataacactaatgaggttactgtattggtagctacatctggagatacaggt
ggcgctgttgccaatggatttttaggtgtaaaaggtgtaaacgtggttattttatatcct
agcggaaaagtaagtgatatacaagaaaaacaattaacaactttagggcaaaatataact
gctttagaagtagacggtgtttttgatgattgccaagatatggttaaacgcgcattttta
gacgaagaattaactagcaaaatgcaattaacatctgcaaactcaattaacgtagcgcgt
tggctaccacaattattttactttatttttgcttataagcagttacataacacgcacaaa
aaaatagttttttctgttcctagtggtaattttggtaacatatgtgctggtatgatggcg
cagcaattgggtttacctattcatcattttatagcatctaacaataaaaataatgttgtt
actacatatttaaaaacagaagaatataatccaaaaccatctgtacaaactataagcaat
gctatggatgttggtaaccctagtaactttattcgtatacaagaaatacacaaaaatgac
tttggcgctttaactgaaaatttatcttcttatagtttttctgatgaagaaacaaaagaa
gcattagcgcatatttacaaaacttataactatgtagctgacccacacggagctgttggt
tatttaggttgcaaagcatatttaaaaaataataatgatgtacattgtgtatttttagaa
actgctcacccaacaaaatttttagatgtagttgaagacgtaattaaagaaaaacaacca
ttgccagagcaaatacaagaagtaatgcacaaaacaaaagtagccaccaaaattggcagc
tacaatgacttaaaatcttacttattaaataactaa

DBGET integrated database retrieval system