KEGG   Cellulophaga lytica DSM 7489: Celly_0286Help
Entry
Celly_0286        CDS       T01434                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Celly_0286
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celly_0286
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Celly_0286
Enzymes [BR:cly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Celly_0286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
297707..299002
Genome map
AA seq 431 aa AA seqDB search
MNYYSLNKKAPNTTFKNAVIKGLAPDKGLYFPESITPLPADFFKNLDNLSNSEIAFTAIK
QFVSPEIPEDVLKTIVEETLSFNFPVVKLDENVSTLELFHGPTMAFKDVGARFMARCLGY
FNKNNTNEVTVLVATSGDTGGAVANGFLGVKGVNVVILYPSGKVSDIQEKQLTTLGQNIT
ALEVDGVFDDCQDMVKRAFLDEELTSKMQLTSANSINVARWLPQLFYFIFAYKQLHNTHK
KIVFSVPSGNFGNICAGMMAQQLGLPIHHFIASNNKNNVVTTYLKTEEYNPKPSVQTISN
AMDVGNPSNFIRIQEIHKNDFGALTENLSSYSFSDEETKEALAHIYKTYNYVADPHGAVG
YLGCKAYLKNNNDVHCVFLETAHPTKFLDVVEDVIKEKQPLPEQIQEVMHKTKVATKIGS
YNDLKSYLLNN
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaattactactcgttaaacaaaaaagcgcctaatactacatttaaaaatgcagttata
aaaggcttggcaccagataaaggattgtactttcctgaaagtataacacctttacctgca
gatttctttaaaaatttagacaatttatctaattcagaaattgcttttacagccattaaa
caatttgtttctcctgaaattccagaggatgttctaaaaaccattgtagaggaaacatta
tcctttaattttcctgtggttaagttagatgagaatgtgtctacattagagctttttcac
ggaccaacaatggcatttaaagatgttggggcacgttttatggctcgttgtcttggctat
tttaataaaaataacactaatgaggttactgtattggtagctacatctggagatacaggt
ggcgctgttgccaatggatttttaggtgtaaaaggtgtaaacgtggttattttatatcct
agcggaaaagtaagtgatatacaagaaaaacaattaacaactttagggcaaaatataact
gctttagaagtagacggtgtttttgatgattgccaagatatggttaaacgcgcattttta
gacgaagaattaactagcaaaatgcaattaacatctgcaaactcaattaacgtagcgcgt
tggctaccacaattattttactttatttttgcttataagcagttacataacacgcacaaa
aaaatagttttttctgttcctagtggtaattttggtaacatatgtgctggtatgatggcg
cagcaattgggtttacctattcatcattttatagcatctaacaataaaaataatgttgtt
actacatatttaaaaacagaagaatataatccaaaaccatctgtacaaactataagcaat
gctatggatgttggtaaccctagtaactttattcgtatacaagaaatacacaaaaatgac
tttggcgctttaactgaaaatttatcttcttatagtttttctgatgaagaaacaaaagaa
gcattagcgcatatttacaaaacttataactatgtagctgacccacacggagctgttggt
tatttaggttgcaaagcatatttaaaaaataataatgatgtacattgtgtatttttagaa
actgctcacccaacaaaatttttagatgtagttgaagacgtaattaaagaaaaacaacca
ttgccagagcaaatacaagaagtaatgcacaaaacaaaagtagccaccaaaattggcagc
tacaatgacttaaaatcttacttattaaataactaa

DBGET integrated database retrieval system