KEGG   Cellulophaga lytica: Celly_0424Help
Entry
Celly_0424        CDS       T01434                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cly  Cellulophaga lytica
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Celly_0424
  Lipid metabolism
   00600 Sphingolipid metabolism
    Celly_0424
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Celly_0424
Enzymes [BR:cly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Celly_0424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
444291..446762
Genome map
AA seq 823 aa AA seqDB search
MQTYKLTALLLFLMFFSSCQEKEIEVLADQDFNKNWLFIKDSIPNAEAITIDDSNWRKVN
VPHDWAIEGPFSDKNNARNGGLPIDGIAWYRKHFTVDAKNKNKQISIEFDGVMDNSKVYI
NGNFVGERHYGYSGFEYDLTPFIKFGENNVIAVQLAPEILSERWYPGAGIYRKVRLKLNE
PIHIPQWGTYITTPKVASNKAVVSVETKLKNTLNTTENIVLETTILDINNTTVAVSSNKI
ELAKASEQKEVQKITVPNPILWDIGKPNLYTAVSRVIKDNKTIDEYTTEFGIRTIEFKKE
GFYLNGKAVELNGVCMHHDLGPLGAAVNYRATERQMQIMQQMGANALRTSHNPPSTEMLQ
VCDRLGIVVIDEAFDEWKEAKVPNGYHKYFDKWAEKDLRDMIKRDRNHPSVIMWSIGNEI
LEQGKKDGWKIAKMLNDICHNEDNTRPTTAGFNYYPASFKNKLAYQIDVVGVNYKPAYYA
EIREQNPDMIFYGSETSSQTSTRGYYEFPLKERVSKETNQVSSYDVNIGPSWTYPPEVEF
EAQKQNPHSLGEFIWTGFDYLGEPTPYGGRDNSTNGYWNDDWPSHASYFAPVDLVGFPKD
RFYLYQSQWTTEPMVHVLPHWNWEGKEGQNIPVYSYTNCDEVELFVNGKSYGKKIKGKDT
TTIFAEYNGFKGGTIDSKYRLSWNVPYQPGSLKVVGYKNGKPVATKEIKTAGKPYKIKLI
ADRTTINASGEDLSFITVRVEDKDGNLCPKANHLINFKVSGNGNLEAVGNGNSASLESFQ
ANYITSFYGKSLAILKATENPGEITLTATADNLTSATITIKTK
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacatataaattaactgctttactactttttctgatgtttttttcttcttgccaa
gaaaaggaaatagaagttttagcagaccaagattttaataaaaactggttatttataaaa
gatagtattcctaatgcagaagccataactattgatgatagcaattggagaaaagtaaac
gtaccacatgattgggctatagaaggtccgtttagtgataaaaataatgcacgtaacggt
ggtttacctatagacggtattgcttggtacagaaaacattttactgtagacgctaaaaac
aaaaacaaacaaatttctatagagtttgatggtgttatggataactccaaagtgtatatt
aacggcaattttgtaggagaacgccattacggttacagtgggtttgagtatgatttaact
ccgtttataaaatttggagaaaacaatgttattgccgtacaattggctccagaaatttta
tctgaaagatggtatcctggcgctggtatttaccgcaaagttcgtttaaagttaaacgaa
ccaatacatattccgcaatggggaacatacattactacacctaaagtagctagtaataaa
gccgttgttagcgtagaaactaaactaaaaaataccctaaatacaactgaaaacattgta
ctagaaactaccattttagacataaacaatacaactgttgctgtttcaagcaacaaaata
gaactagctaaagcatctgaacaaaaagaggtgcaaaaaattacagttcctaaccctatt
ttatgggatattggcaaaccaaacttatacacagctgttagtcgtgttataaaagataac
aagacaatagatgagtacactacagaatttggtattagaactattgagtttaaaaaagaa
ggcttttacttaaacggaaaagcagtagaacttaatggtgtttgtatgcaccatgatctt
ggtcctttgggtgctgctgttaattatagagctacggaacgccaaatgcaaataatgcaa
caaatgggtgcaaatgctctacgtactagtcacaacccaccttctacagaaatgctgcag
gtttgtgatagacttggcattgtggttattgatgaagcttttgatgaatggaaagaggct
aaagtacctaatggttaccataaatattttgacaaatgggcagagaaagatttgcgagat
atgataaaaagagatcgcaaccacccatctgtaattatgtggagtattggaaacgaaatt
ttagaacaaggtaaaaaagatggctggaaaatagctaaaatgttaaatgacatttgtcat
aatgaagacaataccagacctacaactgctggttttaactattaccctgcttcatttaaa
aacaaattagcctaccaaatagatgttgttggtgtaaactacaaacctgcttattatgca
gaaattagagaacaaaaccctgatatgattttttatggatcagaaacatcttcacaaaca
agtactagaggttactatgagtttccattaaaagaaagagttagcaaagaaactaatcag
gtttctagttatgatgtaaatattggtccgtcatggacataccctccagaagtagaattt
gaagcacaaaaacaaaatccacattcgttgggagaatttatttggactggttttgattat
ttaggagaacctactccttatggcggaagagacaactctactaacggatattggaatgat
gattggccatcccacgcatcatattttgcacctgtagatttagtaggttttcctaaagac
aggttttatttgtaccaaagccaatggaccacagagccaatggtacacgtattaccacat
tggaattgggaaggtaaagaaggccaaaacatacctgtatactcgtatacaaattgtgat
gaagtagaactttttgtaaacggtaaatcttatggcaaaaaaataaaaggaaaagatact
actaccatttttgcagaatacaatggttttaaaggtggcactattgactctaaatacaga
ctttcatggaatgtaccttaccaacctggaagcttaaaagttgttgggtataaaaatgga
aaacctgtagctactaaagaaattaaaacagcaggcaaaccttataaaataaaattaata
gcagacagaactactattaatgctagtggagaagatttatcatttattacagttagggtt
gaagacaaagacggtaacttatgtcctaaagcaaatcatctaattaattttaaagtatct
ggtaatggtaatttagaagctgttggcaatggcaactctgcctcattagagtcttttcag
gcaaattatattacatcgttttacggtaaaagtttagccattttaaaagctacagaaaat
cctggtgaaataactctaacagctactgcagataaccttacctctgccacaataactata
aaaactaaatag

DBGET integrated database retrieval system