KEGG   Cellulophaga lytica DSM 7489: Celly_0487Help
Entry
Celly_0487        CDS       T01434                                 

Definition
Dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celly_0487
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celly_0487
  Amino acid metabolism
   00310 Lysine degradation
    Celly_0487
Enzymes [BR:cly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Celly_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(529438..530781)
Genome map
AA seq 447 aa AA seqDB search
MSKFELKLPQMGESVAEATLTTWLKEVGDTIEMDEAVFEIATDKVDSEVPSEVEGVLVEK
LFNVDDIVQVGQTVAIIEISGDVEVSATTEDSAPAAEEKVEETPEVAAIEGSIAVAKETV
ATSQDFSDSDKFYSPLVKNIAKEEGITIAELDAINGTGKEGRVTKTDILNYVENRTSPSS
NGTTAAPKSAPASSAQPTKAPATKAAPVVASDGDEVIPLSRMGKLIAQHMTASVSTSAHV
QSFIEVDVTNLVNWRNKNKNAFLKREGEKLTFTPIFMEAVAFAIKKFPLINISFDGDSVI
KKKNINIGMAAALPDGNLIVPVIKNADQLNLVGMAKVVNDLANRARNNALKPDDIQGGTY
TVTNVGTFGSVFGTPIINQPQVAILALGAIRKVPSVIETPEGDFIGIRSKMFLSHSYDHR
VVNGALGGMFIKAVAEYLEAWDVNREI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaatttgaattaaaattacctcagatgggagaaagtgttgcagaggcaacatta
actacttggttaaaagaagtaggggataccattgagatggatgaggctgtttttgaaatt
gccactgataaggtagattctgaagttccttctgaagtagaaggtgtcttagttgaaaaa
ctttttaacgttgatgatatagtacaagttggacaaactgttgctattattgaaatttct
ggcgatgtagaagtttctgctacaacagaagatagtgcaccagcggctgaagaaaaagtt
gaagaaacaccagaagttgcggctatagaaggttctattgctgtagctaaagaaacagta
gcaacatcacaagattttagtgattcagataaattttactctccattagttaaaaatata
gctaaagaagagggtattactattgcagaattagacgctataaacggtacaggtaaagag
ggcagagttactaaaacagacatattaaattatgtagaaaacagaacatcgcctagtagt
aatggtactacggcagcaccaaaaagcgcacctgcatcatcagcacagccaacaaaagca
ccagcaactaaggcggcaccagttgttgcttcagacggagatgaggttataccactgtct
cgtatgggtaaattaattgcacagcatatgacagctagtgtgtctacatctgcacacgta
caaagttttatagaggtagatgttactaaccttgtaaactggagaaataaaaataaaaat
gcatttttaaagagagaaggagaaaaacttacatttactccaatatttatggaggcagta
gcatttgctattaaaaagtttccgctaataaatatttcttttgatggagattctgtaatt
aaaaagaaaaatataaacataggtatggcagcagctttaccagacggaaacttaattgta
cctgtaattaaaaatgcagatcagttaaatttagttggtatggctaaagttgtaaacgac
ctggcaaacagagcaagaaacaatgctttaaaaccagacgatattcaaggaggtacatat
accgtaaccaatgtaggtacatttggtagtgtatttggcacaccaattattaaccagccg
caagtagcaattttagcattaggagcaatacgtaaagtgccatctgttatagaaactcca
gaaggtgattttataggtatacgttctaaaatgttcttatctcatagttatgatcaccgc
gttgtaaatggtgccttaggtggtatgtttataaaagcagtagcagaatacttagaagct
tgggatgtaaacagagaaatttaa

DBGET integrated database retrieval system