KEGG   Cellulophaga lytica: Celly_0488Help
Entry
Celly_0488        CDS       T01434                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
cly  Cellulophaga lytica
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cly03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(530877..531497)
Genome map
AA seq 206 aa AA seqDB search
MDFSSKLLENAVYEISQLPGIGKRTALRLALHLLKQPKDQTSALSNSLLKLREEIKFCSN
CHNISDVVLCEICANPKRDESIVCVVEDIRDVMAIENTGQYRGLYHVLGGRISPMEGVGP
QNLTIDSLVNKSKEGIIKELIFALSSTMEGDTTNFYIYKQIEGMGLKTSTIARGIAVGDE
LEYADEVTLGRSILNRVPFENSLKLG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggatttctcttctaaattgttagaaaatgcagtgtacgaaatatctcagttgccagga
attggtaagcgtacagctctgcgtttggcattacatttattaaaacaaccaaaagaccaa
actagtgcattatctaatagtttattaaagttaagagaagaaattaaattttgtagcaac
tgccataatatttctgatgttgtcttatgtgaaatttgtgctaacccaaaaagagatgaa
tctatagtttgtgttgtagaagacattagagatgtaatggctatagagaatacagggcaa
tacagaggactgtatcacgttttaggaggtagaatttctcctatggaaggcgttggtccg
caaaatttaacaatagattctttggtaaataaatctaaagaaggtataattaaagagcta
atttttgctttaagttctactatggaaggtgatactaccaacttttatatttacaaacaa
atagaaggtatgggtttaaaaacgtctactatagcacgtggtattgccgttggtgatgaa
ctagagtatgcagatgaggtaacccttggtagaagtatattaaatagggttccttttgag
aattctttaaaattaggatag

DBGET integrated database retrieval system