KEGG   Cellulophaga lytica DSM 7489: Celly_0547Help
Entry
Celly_0547        CDS       T01434                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Celly_0547
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celly_0547
Enzymes [BR:cly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Celly_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
603448..604233
Genome map
AA seq 261 aa AA seqDB search
MDILEKIVLDKRKEVALRKALIPVSQLEASVLFNRPSNSLAVVLKNSSSGIIAEHKRRSP
SKAVINNSLSVQDVATGYQNAGVCGMSVLTDGKYFGGSLDDLLTARAAVQMPLLRKEFII
DEYQILEAKAYGADVILLIAAILTREEIKQFSEFAKSLDLDVLLEVHNQEELQKSIMPSL
DMLGVNNRNLKTFTVSLDTSKSLSALIPNDFVKVSESGISNIEAIKELQPYGYKGFLIGE
NFMKTDNPGDSATNFITSLTS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggatattttagaaaaaatagtactagacaaacgtaaggaagttgctttaagaaaagct
cttattcctgtatctcaactagaggcttcagttttatttaatagacctagtaactcttta
gctgttgtattaaaaaacagtagttctggtattattgcagaacataagagaagatcacca
tcaaaagcagtaataaataatagcctatctgtacaagatgttgctacgggttaccaaaat
gctggcgtttgcggtatgtctgttttaacagatggcaaatattttggtggctctttagat
gatttgctaaccgccagagcagcagtacaaatgccattactacgtaaagagtttattata
gatgagtaccaaatactagaagcaaaagcttatggcgcagatgttattttgttaatagca
gctatacttactagagaagaaataaaacaattttctgagtttgctaaaagtctagactta
gatgttttactagaagtacataaccaagaagaattgcaaaaatctattatgcctagttta
gatatgctaggcgtaaacaaccgtaatttaaaaacttttacggtaagtttagacactagt
aaatctttatctgctttaatacctaatgattttgtaaaagtatctgaaagtggcataagc
aatatagaggccattaaagaattacaaccatacggctataaaggttttttaataggtgaa
aattttatgaagactgataaccctggcgatagtgccactaattttataacatctttaacc
tcatga

DBGET integrated database retrieval system