KEGG   Cellulophaga lytica DSM 7489: Celly_0549Help
Entry
Celly_0549        CDS       T01434                                 

Definition
Tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Celly_0549
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celly_0549
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celly_0549
Enzymes [BR:cly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Celly_0549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
604903..606084
Genome map
AA seq 393 aa AA seqDB search
MNYNVTEKGYYGTFGGAYIPEMLYPNVENLRQNYLKVMAEPDFKAEFDQLLKDYVGRPSP
LYFAKRLSEKYNTKVYLKREDLNHTGAHKVNNTIGQILMAKKLGKKRIIAETGAGQHGVA
TATVCALMGMDCVVYMGEIDIARQAPNVARMKMLGAEVRPALSGSKTLKDATNEAIRDWI
NNPVDTHYIIGSAIGPHPYPDMVTRFQSVISEEIKWQLKEKEGRENPDYVVACIGGGSNA
AGTYYHFLHEEEVGIIAVEAAGKGINSGESAATSALGKEGVIHGCKTLLMQTNDGQITEP
YSISAGLDYPGVGPLHAHLYKTGRGEFYSATDDEAMQSGLELTKLEGIIPAIESSHALAI
FKHKTFKPDDVVVLSLSGRGDKDLDNYIKYFNL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaattataatgtaacagaaaaaggatattacggaacatttggcggtgcctatattcca
gaaatgttatatcctaacgtagaaaacctacgccaaaactatcttaaagtgatggcagag
ccagactttaaagcagagtttgatcagcttttaaaagattacgtaggcaggccgtctcct
ttgtactttgcaaaaagattgtctgaaaagtacaacacaaaagtctatttaaaaagagaa
gacctaaaccatactggtgctcataaggttaacaatactattggccaaattttaatggca
aaaaaactaggtaaaaaacgcattattgctgagaccggcgctggccaacacggtgttgcc
actgctacagtttgtgcactaatgggtatggactgtgtggtgtatatgggtgagatagat
attgcacgtcaagcaccaaacgtagcacgtatgaaaatgctaggtgcagaagtaagacct
gcactgtctggtagtaaaacactaaaagatgcaactaatgaagctattcgtgactggatt
aacaaccctgtagacacacattatattattggttctgctattggcccgcatccttaccca
gatatggttaccagatttcaatctgtaatatctgaagaaataaaatggcaactaaaagaa
aaagaaggacgagaaaatcctgattacgtagtagcttgtattggtggtggtagtaatgct
gctggtacatattatcactttttgcacgaagaagaagttggtattattgctgtagaagct
gcaggtaaaggaataaattctggcgaaagcgctgctacatctgcgcttggtaaagaaggt
gttatacacggttgtaaaacactattaatgcaaaccaatgacggacaaattacagagccc
tactctatttctgctggtttagattatcctggcgttggaccactacacgcacatttatac
aaaacaggaagaggagaattttattctgccacagatgatgaggctatgcagtctggttta
gaattaacaaaattagaaggtattatacctgctatagaaagtagtcacgctttagctatt
tttaaacataaaacttttaaaccagacgatgtggttgtactaagtttatctggccgtggt
gataaagatttagataattacattaaatattttaacttataa

DBGET integrated database retrieval system