KEGG   Cellulophaga lytica DSM 7489: Celly_0550Help
Entry
Celly_0550        CDS       T01434                                 

Definition
Tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Celly_0550
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celly_0550
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celly_0550
Enzymes [BR:cly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Celly_0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
606094..606855
Genome map
AA seq 253 aa AA seqDB search
MNRINKKMQEDKKLLSLYFTAGYPELNNTVKIIEDLEASGIDMIEIGLPFSDPLADGPTI
QNSSTIALKNGMTTNLLFEQLKDIRKTVSIPLIVMGYFNPMLQYGVEAFCKKCAEIGIDG
LIMPDLPLAVYQDEYEAIFKKYNLKNIFLITPQTSDERIKQIDEASDAFIYMVSSASVTG
SKSGFGDEQTAYFKRIASMQLKNPQIVGFGINNNETFTQATEGAKGAIIGSAFIKHLTEN
GVNTIKEFVQKIR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaattaataaaaaaatgcaagaagacaaaaaacttctttcattgtactttaca
gcaggttacccagagcttaacaatacggttaaaataattgaagatttagaggccagcggt
atagatatgatagaaattggattgccttttagtgacccattagcagatggcccaacaata
caaaacagctctacaattgcgcttaaaaatggtatgactaccaatttactttttgagcag
ttaaaagatatacgtaaaactgtttctatacctttaatagttatgggatattttaaccca
atgctacaatatggtgttgaagccttttgtaaaaaatgtgcagaaataggtatagatggt
ttaattatgccagatttacctttggctgtttaccaggatgaatacgaggctatttttaaa
aagtataatttaaaaaacatctttttaattacaccacaaactagtgacgagcgtattaag
cagattgatgaagcttctgatgcatttatttatatggtaagttctgctagtgtaacgggt
tctaagtctggttttggagatgaacaaactgcttattttaaacgcatagctagtatgcaa
cttaaaaacccacaaattgttggttttggtattaataataacgaaacatttacacaagca
acagaaggtgcaaaaggtgctattattggctccgcatttataaaacaccttacagaaaat
ggtgtaaatactattaaagagtttgtgcaaaaaataagataa

DBGET integrated database retrieval system