KEGG   Cellulophaga lytica DSM 7489: Celly_0550Help
Entry
Celly_0550        CDS       T01434                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
cly00260  Glycine, serine and threonine metabolism
cly00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cly01100  Metabolic pathways
cly01110  Biosynthesis of secondary metabolites
cly01130  Biosynthesis of antibiotics
cly01230  Biosynthesis of amino acids
Module
cly_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celly_0550
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celly_0550
Enzymes [BR:cly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Celly_0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADY28385
JGI: Celly_0550
UniProt: F0RA56
Position
606094..606855
Genome map
AA seq 253 aa AA seqDB search
MNRINKKMQEDKKLLSLYFTAGYPELNNTVKIIEDLEASGIDMIEIGLPFSDPLADGPTI
QNSSTIALKNGMTTNLLFEQLKDIRKTVSIPLIVMGYFNPMLQYGVEAFCKKCAEIGIDG
LIMPDLPLAVYQDEYEAIFKKYNLKNIFLITPQTSDERIKQIDEASDAFIYMVSSASVTG
SKSGFGDEQTAYFKRIASMQLKNPQIVGFGINNNETFTQATEGAKGAIIGSAFIKHLTEN
GVNTIKEFVQKIR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaattaataaaaaaatgcaagaagacaaaaaacttctttcattgtactttaca
gcaggttacccagagcttaacaatacggttaaaataattgaagatttagaggccagcggt
atagatatgatagaaattggattgccttttagtgacccattagcagatggcccaacaata
caaaacagctctacaattgcgcttaaaaatggtatgactaccaatttactttttgagcag
ttaaaagatatacgtaaaactgtttctatacctttaatagttatgggatattttaaccca
atgctacaatatggtgttgaagccttttgtaaaaaatgtgcagaaataggtatagatggt
ttaattatgccagatttacctttggctgtttaccaggatgaatacgaggctatttttaaa
aagtataatttaaaaaacatctttttaattacaccacaaactagtgacgagcgtattaag
cagattgatgaagcttctgatgcatttatttatatggtaagttctgctagtgtaacgggt
tctaagtctggttttggagatgaacaaactgcttattttaaacgcatagctagtatgcaa
cttaaaaacccacaaattgttggttttggtattaataataacgaaacatttacacaagca
acagaaggtgcaaaaggtgctattattggctccgcatttataaaacaccttacagaaaat
ggtgtaaatactattaaagagtttgtgcaaaaaataagataa

DBGET integrated database retrieval system