KEGG   Cellulophaga lytica: Celly_0791Help
Entry
Celly_0791        CDS       T01434                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cly  Cellulophaga lytica
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Celly_0791
Enzymes [BR:cly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Celly_0791
Exosome [BR:cly04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Celly_0791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
907806..909302
Genome map
AA seq 498 aa AA seqDB search
MEKYILALDQGTTSSRAIVFNKMGNIISVAQKEFTQYFPKPGWVEHDPDEIWSTQAGVAT
EAITKKGLDVKNIAAIGITNQRETVVVWDKKTGKPVYNAIVWQDKRTAAYCDELKKAGHT
DLIKQKTGLVIDSYFSGTKIKWILDNVEGARERAEAGDLLMGTIDSWLIWNFTKGNKHVT
DVSNASRTLLFNINTLEWDDELLELLTIPKSMLPEVKESSEVYGHTQSVFYDSKIPISGI
AGDQQAALFGQMCTKPGMVKNTYGTGCFMLMNIGKKPTLSKNNLLTTIGWKINGETHYAL
EGSIFIGGAVVQWLRDSLKIIRTSSEAETLANSITSSEGVYFVPSFAGLGAPHWNQQAQG
TIFGLTRGSTDAHIARAALESIAYQTMDILKAMEADSGILIKELRVDGGATVNNLLMQFQ
ANVLQTTTIRPKVVETTAMGAAFLAGLAVGYWDSPKEIEEIWQTDKRFEPVIENEEILEG
IKGWYKAIKALEYWTTLN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatatatattagcattagaccaaggcacaacaagctctagagcaattgtattt
aataaaatgggaaacattatatctgttgctcaaaaagagtttacacagtactttcccaaa
ccaggctgggtagaacatgaccctgacgaaatttggtctacacaagctggtgttgctaca
gaagctattacaaaaaaaggactagatgtaaaaaatattgctgcaattggcattacaaac
caaagagaaactgtagttgtttgggataaaaaaacaggtaaacctgtttataacgctatt
gtttggcaagacaaaagaactgctgcatattgtgatgaattaaaaaaagcaggacacaca
gatcttattaaacaaaaaacaggccttgtaatagactcttacttttctggaactaaaata
aaatggattttagataacgtagaaggcgctagagaacgtgcagaggctggtgatctatta
atgggcactatagactcttggcttatttggaactttacaaaaggaaacaaacacgttaca
gatgttagtaatgcgtctagaacgttactatttaacattaatactttagaatgggatgat
gagctattagagctacttaccattcctaaaagtatgttaccagaggtaaaagaatctagc
gaggtctacggtcatacacaatctgttttttatgattctaaaattcctatttctggcatt
gcaggagatcagcaagctgcgttatttggacaaatgtgtaccaagcccggaatggtaaaa
aacacatacggcacaggttgttttatgcttatgaatattggtaaaaaaccaacattatct
aaaaataacttactcaccactataggttggaaaattaacggagaaacacattatgcatta
gaaggcagtatttttataggaggagctgttgtacaatggcttagagattctttaaaaatt
attagaacatcttcagaggcagaaacgttagctaacagcattacaagctcagaaggggtt
tactttgttccttcttttgctggtttgggggctcctcattggaaccaacaagcacaaggt
actatttttggattaacaagaggcagcacagatgcacatattgcaagagcagctttagag
tctattgcataccaaacaatggatattttaaaagctatggaggcagattctggcatttta
attaaagagttacgagtagatggtggagctactgtaaataatttactaatgcagtttcag
gcaaatgttttacaaactactactataagacctaaagtggtagagaccactgctatggga
gctgcttttttagcaggcctagctgtaggctactgggatagtccaaaagaaattgaagaa
atttggcaaacagataaacgttttgaaccagttatagaaaatgaagaaattttagaaggc
attaaaggttggtacaaggccattaaagcacttgaatattggacaaccttaaactaa

DBGET integrated database retrieval system