KEGG   Cellulophaga lytica: Celly_0965Help
Entry
Celly_0965        CDS       T01434                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cly  Cellulophaga lytica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cly00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1079916..1082909
Genome map
AA seq 997 aa AA seqDB search
MFKRLTYLPLFLMLLSLSSVAQSPVEKHGRLQVDGNRILNASGEITSLAGNSLFWSNAGD
TSDFYNAETVDFLAENWNSSLIRIAMGVKENWDGGNGYIDSPQEQEAKIRKVIDAAIANG
IYVIIDWHTHEAELYTDEAVDFFTRMADLYGDTPNVMYEIYNEPIYQSWPVIKNYAEQVI
AGIRSKDPDNLIIVGTSNYSQQVDVASADPISDTNVAYTLHFYAAFNPHDNLRNVAQTAL
DNNVALFVTEWGTILNTGQGEPDKESTNTWMAFLKEKGISHANWSLSDKAFPETGSVVQA
GQGVSGLISNKLTASGEIVKNIIQNWDTETSTGPKTTQCSTIECIRAAMETAQAGDEIII
APGNYNFQDKIQGAFNRSVYLYGSANGNSTNPIILRGESATNPPVFSGLDYNNGYLLSIE
GDYWNIKDIEFKTGSKGIVLDNSNGSKLKNLVVHDIGEEAIHLRDGSSNNSIDGCTIYNT
GRTKPGFGEGLYVGSDKGQHDTYERACNNNTIENCTVGPNVTAEGVDVKEGTMNTIIRNC
VFSAEGISGENSSDAFIDLKGAYGFVYRNTFNVDGSEVINTGVDFLDRGTGFNTGFRNAI
FENTYNLGSRASEISTARKKQGSPEQTHVWDNIRNPNSVDFPISDGTENLVNNFCPDWNI
EPCNPVDETNQAPTISFLSPVNNITLVEGYNLQVEVNATDADGTIDNVKLYIDNNLVRQI
NSTSYKWGHSDSPNTDELNGLTEGTYTLKAIATDNDGASTETQFTLTVITEQSPSENCDF
NTPSSTGLEDFDIKKFSNVFVLGSGGPSLSNLKTFTINWNSQYNGLYQFSINTNNGVPDY
YINLKPKITFQFKNANPEISISNSLIPNFDGDYWVTSDNGNFVMVSKTNNFTIYFSNDAT
APICNVTPSNQISKITDDSSINFKLYPNPALDETIFVSAEDEKLVSVKIYDLQGKLLIDK
QDNSALLKLNISEILPGTYVIEITGTTSKKRSLFVKK
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaggcttacgtatctacctttgtttttaatgctgctctcactaagttcagta
gctcaatctcctgtagaaaaacatggccgtttacaagttgacggaaaccgcattcttaat
gcgtctggagaaattacgagcttagctggtaacagcctcttttggagtaatgctggagac
acctccgatttttataatgcagaaactgttgattttttagcagaaaactggaatagctca
cttattagaatagctatgggcgtaaaagaaaattgggatggcggaaatggctatattgat
agtccgcaggagcaagaagctaaaattagaaaagttattgatgcagctattgctaacggc
atatatgtaataatagactggcacactcacgaagcagagttatacacagatgaggctgtt
gacttttttaccagaatggcagacctatacggagatactcccaatgtaatgtatgaaatt
tataacgagcctatataccaaagttggcctgttattaagaattatgcagagcaagtaatt
gctggtatacgttctaaagacccagataatttaataattgtaggtactagcaattattct
cagcaagttgatgtagcatcagcagacccaatatctgatactaatgtggcatatacttta
catttttatgcagcatttaacccgcatgataacttaagaaatgtagcacagacagcatta
gataataatgttgctttgtttgttacagaatggggtacaattttaaataccggacaagga
gaaccagacaaagaaagcactaatacttggatggcctttttgaaagaaaaaggtataagt
cacgctaattggtctttgagtgacaaagcttttcctgaaacagggtctgtagttcaagca
ggacaaggtgtatctggtttaattagcaataaacttacagcctctggtgaaattgtaaaa
aacatcatccaaaactgggatacagagacctctacaggacctaaaacaacacaatgtagt
actatagaatgtattagagctgcaatggaaacagcacaagcaggagatgaaattataatt
gcccctggaaactacaattttcaagacaagatacaaggtgcctttaaccgtagtgtttac
ctttatggtagtgctaacggaaacagtacaaaccctattatattaagaggcgaaagcgct
acaaaccctcctgttttctcaggattagattataacaatggctacctattaagtattgaa
ggtgattattggaatattaaagatatagagtttaaaactgggtctaaaggtattgttctt
gacaattctaatggtagtaaattaaaaaaccttgttgttcatgatattggagaagaagct
attcacttgcgtgatggatctagcaataatagtatagatggttgcactatatacaataca
ggtagaactaaacctggttttggtgaaggtttatatgtaggctcagataaaggacaacat
gacacttatgaaagagcttgtaacaataacactattgaaaactgtaccgttggacccaat
gtaacagcagaaggcgtagatgttaaggaaggtacaatgaacactattataagaaattgc
gtgttttctgcagaaggaatttcaggagaaaatagctcagatgcttttattgatttaaaa
ggagcctatggttttgtatacagaaacacgtttaatgttgatggttctgaagtaataaat
actggagtagactttttagatagaggtacaggatttaatacaggttttagaaatgcaata
tttgaaaatacatataaccttggcagtagagcttcagaaatttcaactgctcgtaaaaaa
caaggttctcctgaacaaactcacgtttgggataatattagaaaccctaattctgttgat
tttccaataagtgatggtacagaaaatctagtaaataatttctgcccagattggaatata
gaaccatgtaatcctgtagacgaaaccaaccaagcacctacaataagcttcctatctcct
gttaacaatattactttagttgaaggttataatttacaagttgaagttaatgctactgat
gcagatggaactattgataatgtaaaactttatatagataacaatttagttaggcaaata
aattctacttcatataaatggggccattctgattctccaaatacagatgaacttaatggt
cttacagaaggaacttataccttaaaagcaattgcaactgataacgacggggcttctaca
gaaacgcaatttacgttaactgtaataacagaacaaagtccgtctgagaattgtgacttt
aatacaccttcttcaactggtttagaagattttgacattaaaaagttttctaacgttttt
gtgttaggatctggcggaccatctttaagtaatttaaaaacatttactattaattggaat
tcgcaatacaatgggttatatcaattttcaataaacacaaacaacggtgtacctgattat
tatataaatttaaaaccaaaaattacctttcagtttaaaaatgcaaatccagaaatatct
attagcaatagcttaattcctaattttgatggtgattactgggtaacatcagataacggt
aattttgtgatggtatctaaaactaataattttacgatatactttagtaatgacgctact
gctcctatttgtaatgttacgcctagtaaccaaataagtaaaattactgatgattctagt
attaattttaagctttaccctaatcctgctttagacgaaactatttttgtgagcgctgaa
gatgaaaaactagtatccgttaaaatttatgatttacaaggaaaactattaattgacaaa
caagataatagtgcgttgttaaaattaaatatttctgaaattttacctggaacatatgtt
atagaaattacaggtacaacttctaaaaaacgttctttatttgttaaaaaatag

DBGET integrated database retrieval system