KEGG   Cellulophaga lytica DSM 7489: Celly_0988Help
Entry
Celly_0988        CDS       T01434                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
cly00860  Porphyrin and chlorophyll metabolism
cly01100  Metabolic pathways
cly01110  Biosynthesis of secondary metabolites
cly01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Celly_0988
Enzymes [BR:cly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Celly_0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 SAS-6_N
Motif
Other DBs
NCBI-ProteinID: ADY28817
JGI: Celly_0988
UniProt: F0RE55
Position
complement(1099262..1100014)
Genome map
AA seq 250 aa AA seqDB search
MSMKIKTILVSQPEPKMENSPYSRLIEKEKLKVDFRPFIHVEGVDAKTVRQQKIDLNNFT
AIVLTSRNSVDHFFRIAEEMRFKVPDSMKYFCQSEAVAYYLQKYVVYRKRKIYVGKRMFA
DLAPLLKKYKTEKFLLPSSDVLKPIVPETLDGLGLDWKRAIFYKTVISDLSDLRDVYYDI
LVFFSPSGIESLLKNFPDFEQNDTKIAVYGNTTVNAATDAGLRIDILAPTPETPSMTMAL
QKYITTANKK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaagataaaaacgattttggtttctcaaccagaacctaaaatggagaactct
ccctattcaagacttattgaaaaggagaagttaaaagtagattttagaccgtttatacat
gtagagggagttgatgctaaaacagtgcgtcagcaaaaaattgatttaaataactttaca
gcaatagtgctaacgagtagaaattctgtagatcacttttttagaatagcagaagaaatg
cgttttaaagtgccagattctatgaagtacttttgccagtctgaggctgtggcttactat
cttcagaaatatgtagtttaccgtaaacgtaaaatatatgttggtaaaagaatgtttgca
gatttagccccgttgttaaaaaagtataaaacagaaaaatttcttttaccttcttcagat
gtattaaagccaattgttcctgaaacattggatggtcttggtttggattggaagagagct
attttttacaaaacagtaattagtgatttgtctgacttaagagatgtgtattatgatata
cttgttttctttagtccgtctggaattgaatctttattaaagaattttcctgactttgaa
cagaatgatactaaaatagctgtttacggaaatacaacagttaatgctgctacagatgct
ggtttacgtatagatatacttgcgccaacaccagaaacgccatctatgacaatggcttta
cagaagtacattactactgcaaataaaaaataa

DBGET integrated database retrieval system