KEGG   Cellulophaga lytica DSM 7489: Celly_1821Help
Entry
Celly_1821        CDS       T01434                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
cly00020  Citrate cycle (TCA cycle)
cly00310  Lysine degradation
cly01100  Metabolic pathways
cly01110  Biosynthesis of secondary metabolites
cly01120  Microbial metabolism in diverse environments
cly01130  Biosynthesis of antibiotics
cly01200  Carbon metabolism
Module
cly_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cly_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celly_1821
  Amino acid metabolism
   00310 Lysine degradation
    Celly_1821
Enzymes [BR:cly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Celly_1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADY29644
JGI: Celly_1821
UniProt: F0RC10
Position
2039143..2040363
Genome map
AA seq 406 aa AA seqDB search
MILEMKVPSPGESITEVEIAEWLVQDGDYVEKDQAIAEVDSDKATLELPAEVSGVITLKA
EEGDAVAVGAVVCLIDTSAAKPEGADDAPAKEEKKEETAPKAEAPKPAETAKTYATGTAS
PAAKKILSEKGIEASAVKGTGKDGRVTKDDAVKAVPSMGTPTTGGNRGETRSKLSMLRRK
VAERLVSAKNETAMLTTFNEVDMSPIFALRSQYKDDFRAKHGVGLGFMSFFTKAVVRALE
MYPSVNAMIDGKEMISYDFADISIAVSGPKGLMVPVIRNAENLTFRGVEAEVKRLAIRAR
EGEITVDEMTGGTFTITNGGVFGSMLSTPIINPPQSAILGMHNIVERPIAKNGEVVIAPI
MYVALSYDHRIIDGKESVGFLVAVKEALENPEELLMNNDVKKALEM
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaaatgaaagtcccttcaccgggagaatcgataaccgaagtagaaatagcg
gaatggctagtgcaagacggagattatgtagagaaagatcaagctattgcagaggtagat
tcagataaagctaccttagaacttccagcagaagtaagcggagtaattacattaaaagca
gaagaaggtgatgcagtagcagtaggtgccgttgtttgtttaatagatacatctgcagca
aaaccagaaggtgctgatgatgcgcctgctaaagaagagaaaaaagaagaaactgcacca
aaagcagaggctccaaagcctgcagaaactgcaaaaacatatgcaacagggacagcgtct
cctgcagctaaaaaaatattaagtgaaaaaggaattgaggcatctgctgtaaaaggtaca
ggtaaggatggtagagtaactaaagatgatgctgtaaaagctgtgccatctatggggaca
ccaactactggaggtaaccgaggagaaactcgttctaaattatcaatgttacgtcgtaaa
gtggcagagcgtttggtttcagctaaaaatgaaacggctatgcttactacttttaacgag
gtagatatgtctcctatttttgcattgcgtagccagtacaaagatgactttagagctaaa
cacggtgttggtttaggttttatgtctttctttactaaggcggttgtacgtgcattagag
atgtacccatctgtaaatgcaatgatagatggtaaggaaatgatttcttatgattttgca
gatattagtattgctgtatctggaccaaaaggtttaatggttcctgtaattagaaatgcg
gaaaacttaacttttagaggagtagaagcagaggtaaaacgtttggctattagagctcgt
gaaggagaaattacagttgatgaaatgacaggaggaacatttactattactaatggtggt
gtttttggttctatgttatctacaccaattattaatcctccgcaaagtgctattttaggt
atgcacaatatagtagagcgtcctatagctaaaaatggtgaggttgttattgctcctatt
atgtatgtggctttatcttatgatcatagaattatagatggtaaagaatctgttggtttc
ttagttgcagttaaagaagcattagaaaatccagaagaattattaatgaataatgatgtt
aagaaggcgttagaaatgtag

DBGET integrated database retrieval system