KEGG   Cellulophaga lytica: Celly_1876Help
Entry
Celly_1876        CDS       T01434                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cly  Cellulophaga lytica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cly00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Celly_1876
Enzymes [BR:cly01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Celly_1876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2105128..2105709
Genome map
AA seq 193 aa AA seqDB search
MITHLRGKLVEKNPTFLVIECNGVGYFVNISLHTLSKVSDAENIQLYTHLQVKEDSHTLF
GFAEKSEREIFRLLISVSGIGPSIARTMLSSLSPAQVRDAIAGGDVATIQSVKGIGAKTA
QRVILDLKDKVLKIYDIDEVSTSSNNTNKEEALSALEVLGFARKQAEKTVDVVVSQDPTL
SVENIIKLALKNL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgattacacatttaagaggaaaattagtagagaaaaatccaacatttttagtaattgag
tgtaatggtgtaggttactttgtaaacatatcactgcataccttatccaaggtgtctgat
gcagaaaatattcagctgtatacgcatttacaagtaaaagaagactcacacacacttttt
ggttttgcagaaaaatctgaacgagaaatttttagattattaatttctgtatctggtata
ggccctagtattgcacgtacaatgttatcatcattatcacctgcccaggtaagagatgca
attgcgggcggagacgttgcaactatacaatctgtaaaaggtattggagcaaaaactgca
cagcgtgtaatattagatttaaaagataaagtattaaaaatatacgatattgatgaagtt
tctacttcttcaaacaatacaaataaagaagaagcgttatctgctttagaggttcttggt
tttgcacgtaagcaagcagaaaaaactgttgacgtagttgttagtcaagacccaacatta
agcgttgaaaacattattaagttggcgctgaaaaatttgtaa

DBGET integrated database retrieval system