KEGG   Cellulophaga lytica DSM 7489: Celly_1908Help
Entry
Celly_1908        CDS       T01434                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
cly00010  Glycolysis / Gluconeogenesis
cly00620  Pyruvate metabolism
cly00640  Propanoate metabolism
cly00680  Methane metabolism
cly01100  Metabolic pathways
cly01110  Biosynthesis of secondary metabolites
cly01120  Microbial metabolism in diverse environments
cly01130  Biosynthesis of antibiotics
cly01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celly_1908
   00620 Pyruvate metabolism
    Celly_1908
   00640 Propanoate metabolism
    Celly_1908
  Energy metabolism
   00680 Methane metabolism
    Celly_1908
Enzymes [BR:cly01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Celly_1908
Lipid biosynthesis proteins [BR:cly01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Celly_1908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADY29731
JGI: Celly_1908
UniProt: F0RCN4
Position
2142823..2144730
Genome map
AA seq 635 aa AA seqDB search
MSNYHIKHLEEYFQVYRKSVRNPEAFWEEIAEEHFLWRKKWDNVLSWDFSKPEVKWFENA
KLNITENCIDRHLTTRGEKTAILFEPNNPNEEAQHISYYELHKRVCKMANVLKENGVKKG
DRVCIYLPMIPELAVSLLACARIGAIHSVVFAGFSSNALATRINDSDCKLVITSDGSFRG
KKSIDLKGIVDVALNDCPGVKTVLVAKRTNAEITMVEGRDKWLQPLLDEAYGDCVAEIMD
AEDPLFILYTSGSTGTPKGMVHTTGGYMVYTAYTFKNIFQYKENDIYWCTADIGWITGHS
YIVYGPLANGATTVMFEGVPSYPDFGRFWEVVEKHKVTQFYTAPTAIRALAKENMDFVEN
HDLSSLKVLGSVGEPINEEAWHWYNNNVGKNNSPIVDTWWQTETGGIMISPIPYVTPTTP
TYATLPFIGIQPALMDENGQEVKGNQVEGRLCIKYPWPSIARTIWGNHERYRDTYFSAYK
DKYFTGDGALRDGVGYYRITGRVDDVIIVSGHNLGTAPIEDTINEHPAVAESAIVGFPHD
VKGNALYGYVILKEFGETRDRDNLRNEINQQITEHIGPIAKLDKIQFVTGLPKTRSGKIM
RRILRKIASNDTGNLGDISTLLNPEIVKEIMDNSL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattatcacattaagcatttagaggagtattttcaggtataccgaaaatctgta
cgtaacccagaagcattttgggaagaaatagctgaagaacattttttatggaggaaaaag
tgggataatgttttaagttgggatttttctaaaccagaggttaaatggtttgaaaatgca
aaactgaatattacggagaattgtatagacagacatttaacaactagaggagaaaaaaca
gcaattctttttgaacctaacaaccctaatgaggaagcgcaacacattagttattacgag
ttgcataagcgtgtttgtaaaatggctaatgtattaaaagaaaacggcgttaaaaaaggt
gatagggtttgtatttacttacctatgattccggaattagcagtttctttattagcttgt
gcaagaataggagctatacattctgttgtttttgcaggcttttcttctaatgcattggca
acaagaattaatgactctgattgtaaacttgtaattacctctgatggttcttttagaggt
aaaaagtctattgatttaaaaggtattgtagatgttgctttaaatgattgtcctggggta
aaaactgttttggtagcaaaacgtaccaatgcagagattacaatggtagaaggtagggat
aagtggttacaaccactgttagatgaagcttatggagattgtgtggcagaaataatggat
gcagaagatccattatttattttatatacatctggttctactggtacgccaaaaggtatg
gtacacactacaggtggttatatggtgtatacagcgtatacgtttaaaaatatttttcag
tataaagaaaatgatatttattggtgtacagcagatattgggtggattactggccactct
tacattgtttatggtcctttagcaaatggcgctactacagtaatgtttgaaggtgtgcct
tcttatccagattttggacgcttttgggaagttgtagaaaaacataaagtgactcagttt
tataccgcaccaacagctattagagctttagcaaaagaaaatatggattttgtagaaaac
catgatttatcttccttaaaagtattgggctctgtaggcgaacctataaatgaggaagcc
tggcattggtataacaataatgtaggtaaaaataatagtcctattgtagatacgtggtgg
caaacagaaactggtggaattatgatttctcctataccgtatgttacaccgacaacacct
acatatgcaacgttgccttttattggtatacaacctgccttaatggatgaaaacggacaa
gaagtaaaaggaaatcaagtagaagggcgtttgtgtattaaatatccctggccttctatt
gcaagaactatttggggcaatcatgaaagatatagagatacctatttttctgcctataaa
gacaaatattttacaggtgatggcgcattaagagatggtgttggttattacagaattaca
ggtcgtgtagatgatgttattattgtatctggacataatttaggtaccgcaccaattgaa
gataccataaatgagcatccggctgtagcagaatctgcaattgtaggttttccgcatgat
gtaaaaggaaatgctttgtatggttatgttattttaaaagagtttggtgaaactagagat
agagataatttacgaaatgaaataaatcagcaaataacagaacacattggacctattgct
aagctagataaaatacaatttgtaactggcctgcctaaaacaagaagtggtaaaattatg
cgtcgtattttgcgtaaaatagcttctaatgatacggggaatttaggtgatattagtacg
ttgctaaatccagaaattgttaaggaaattatggataactcactataa

DBGET integrated database retrieval system