KEGG   Cellulophaga lytica: Celly_1950Help
Entry
Celly_1950        CDS       T01434                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cly  Cellulophaga lytica
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Celly_1950
   00670 One carbon pool by folate
    Celly_1950
Enzymes [BR:cly01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Celly_1950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2188245..2188742)
Genome map
AA seq 165 aa AA seqDB search
MQKIIAIAAAAENNALGKDNDLLWHLPDDFKRFKKITTGNPIVMGRKTFESFPKPLPNRK
HIVITRDKNYTINYSNCVVVHSLEDALKATQQEETVFIIGGGEIYKLALEYTQKIELTRV
HATFDADTFFPELNKENWEVVFEEYHPKDEKHKLDFTYLTYVRKC
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaaaataattgctattgctgctgcggcagaaaacaatgccttaggaaaagacaat
gatttgctttggcacttgccagatgactttaaacgttttaaaaaaatcactacaggcaac
ccaattgttatgggcagaaaaacttttgagagcttccccaaacccctccctaacagaaag
catatagttattacaagagacaaaaactacactattaattatagcaattgtgtggttgta
cactctttagaggacgcgttaaaggccacccaacaagaagaaacagtgtttataattggc
ggcggagaaatttacaagctagctttagagtacacgcaaaaaatagaacttacaagggta
cacgcgacttttgacgccgacacattttttcctgaactaaataaagaaaattgggaagtg
gtttttgaagaataccacccaaaagatgaaaaacacaaattagattttacatatttaaca
tatgtacgcaaatgctaa

DBGET integrated database retrieval system