KEGG   Cellulophaga lytica DSM 7489: Celly_2018Help
Entry
Celly_2018        CDS       T01434                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Celly_2018
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Celly_2018
Enzymes [BR:cly01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Celly_2018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2266522..2267985
Genome map
AA seq 487 aa AA seqDB search
MKLLKDILYGVGIVAVNGTTDTMVNAICFDSRKVGLDDVFVAVKGTLVDGHSYIDTALNA
GANAIICETMPVNLVNGITYVQVKNGNAALAIMASNFYGTPSKNLKLVGVTGTNGKTTIS
SLLYQLFKKAGYKVGLLSTIKIMIDDKEIKATHTTPDAITINKSLAEMNNAGVEFCFMEV
SSHGIHQKRIEGLVFEGAIFTNLSHDHLDYHKTFAEYRDTKKLLFDGLPKTAWALTNIDD
KNGAVMLQNTKAKKQTYALKTYADFRAQILENQFSGQLLKIDDNELWSKLIGDFNAYNML
AIYATAQLLGLEKMEILRLLSELENVDGRFQYYISGKNITAIVDYAHTPDALKNVLNTIN
ALRTGNEDVITVVGCGGDRDKSKRPVMGHIASEMSTKVVFTSDNPRTESPSEILKEVEAG
VEAQNTRKVLTIENREQAIKTACQLAQPKDIILIAGKGHETYQETNGVRIDFDDYKIVKQ
LLTSLEK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattattaaaagacatattatacggtgtaggtattgttgctgtaaatggcactaca
gatactatggttaatgccatatgttttgactctagaaaagtagggttagatgatgtattt
gtagctgtaaaaggcacacttgtagatggtcatagttatatagataccgctttaaatgct
ggtgcaaatgctataatatgtgaaactatgccagttaacctggttaatggtattacatat
gtacaagtaaaaaatggtaatgctgccttggctataatggcttctaatttttacggtacg
ccatctaaaaatttaaaactagttggtgtaacaggtactaatggtaaaaccactattagc
agcttgttgtatcaattatttaaaaaagcaggttataaggtgggtttactatcaactatt
aaaataatgatagatgataaagagattaaggcaacacatacaacaccagatgctattaca
ataaacaaatctttggcagagatgaataatgcaggagtagagttttgttttatggaggtg
agctctcacggtattcatcaaaaaagaatagaaggtttggtttttgaaggcgccattttt
accaatttatctcatgatcatttagactatcataaaacttttgcagaatatagggatact
aaaaagttgttgtttgatggtctgccaaaaacagcatgggcacttaccaatatagatgat
aaaaatggtgctgttatgctgcaaaataccaaggcaaaaaagcagacatacgcattaaaa
acatacgcagactttagagctcaaatattagaaaatcagtttagcggacaattgctaaag
attgatgataatgagctttggtctaaattaataggagattttaatgcttacaatatgctt
gctatatatgcaactgcgcaattgttaggattagaaaaaatggaaattctacgtctttta
agtgaattagaaaacgtagacggaagatttcaatattacatatctggtaaaaatattaca
gctatagtagattatgctcatactccggatgctttaaaaaatgtactgaacactatcaat
gcattgaggacaggaaatgaagacgtcatcaccgttgtggggtgtggtggcgacagagac
aagtcaaaacgtccggttatgggtcatattgcttcagaaatgagtacaaaagtggttttt
acatcagataatccaaggacagaatctccttcagaaattttaaaagaggtagaggctggt
gtagaagcgcaaaatacgcgcaaggtgttaacaatagaaaatagagagcaagcaataaaa
actgcttgtcagttagcacaacctaaagatattattttaatagcaggtaaaggtcatgaa
acataccaagaaactaatggtgtgcgcatagattttgacgattataaaattgtaaaacaa
ttactaacaagtttagaaaagtaa

DBGET integrated database retrieval system