KEGG   Cellulophaga lytica: Celly_2063Help
Entry
Celly_2063        CDS       T01434                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cly  Cellulophaga lytica
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Celly_2063
Enzymes [BR:cly01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Celly_2063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2323132..2324076
Genome map
AA seq 314 aa AA seqDB search
MSTTNNYAGIPDEFAQLETAKVVLIPVPYDGTSTWGKGADKGPEAFLVASENMELYDIET
GTEPYQQGIYLADAITENSSPEAMVDEVHKITKKYIKRNKFVTLFGGEHSISIGTIRAFN
ECFNNLTVLHIDAHADLRASYEGTACNHACAVHEASQQTNLLQVGIRSMDAIEKTYMDEE
KTFFAHDMVNDEYWMDKVVDQMTENVFITLDLDALDPSILPSTGTPEPGGLFWYETLEFL
KQVFTEKNVVGFDIVELCPNKADKSSDFLAAKLYYKMLSYKFMGEGVDDAYDNTYAIDLK
AGNSTISKFEEDED
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaacaaataattacgcaggcattccagatgagtttgcgcaattggagaccgca
aaagtagttttaatcccagttccttatgacggaacaagtacatggggaaaaggagcagat
aaagggccagaggcttttttagttgcatcagaaaatatggaattgtacgatattgaaacc
ggtacagaaccataccaacaaggaatataccttgctgatgcaattacagaaaatagctcg
ccagaagctatggtagacgaggtgcataaaatcactaaaaagtacattaagcgtaacaag
tttgtaacgttatttggtggtgaacattctatttctataggtactattagggcttttaat
gagtgttttaataacctaactgttttgcatattgatgcacatgcagatttaagagcatct
tatgagggaacagcttgtaaccacgcttgcgcagtgcatgaggcaagtcaacaaactaat
ttgttacaagtaggtatacgtagtatggatgctatagaaaaaacatatatggatgaagaa
aaaacattctttgctcatgatatggttaatgatgagtattggatggataaggttgtagac
caaatgacagaaaacgtttttattaccttagatttagatgctttagacccatctatatta
ccatctacaggaacaccagaaccaggaggtttgttttggtatgaaactctagagttttta
aaacaagtatttacagaaaaaaatgttgtaggttttgatattgttgaactttgcccaaat
aaggcagataaatcgtcagattttttagcagcaaaattatactacaaaatgttaagttat
aaatttatgggtgaaggtgtagatgatgcttatgataatacatatgctatagatctaaaa
gctggtaactctactatttcaaaatttgaagaagatgaagactaa

DBGET integrated database retrieval system