KEGG   Cellulophaga lytica DSM 7489: Celly_2227Help
Entry
Celly_2227        CDS       T01434                                 

Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
cly00790  Folate biosynthesis
cly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Celly_2227
Enzymes [BR:cly01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Celly_2227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ADY30047
JGI: Celly_2227
UniProt: F0RFS2
Position
2489931..2490593
Genome map
AA seq 220 aa AA seqDB search
MDKNNIETVGDNHIATSVDTPLRKNAFLKSDDEKISAIQHHFKKIMEELGLDITDDSLSG
TPYRVAKMYVKELFYGLDPKNKPKLSVFENKYAYNKMLVEQNITIDSSCEHHFLPITGFA
HIAYVPKDKVIGLSKINRLVDYYAHRPQVQERLSLQILKDLQNTLETQDVIVMVTAKHLC
VSSRGIKDKNSFTTTIEYGGCFTNEQTRNDFLKIIEKTTV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaataatatagaaacagtaggagataaccatatagctacaagtgtagatact
cctttgcgtaaaaatgcttttctaaagtctgatgatgaaaagataagcgctattcagcat
cactttaaaaaaataatggaagagttaggtttagatattacagacgatagcttatctggt
acgccatatagagttgcaaaaatgtatgttaaagaacttttttatggtttagatcctaaa
aacaagccaaaattatctgtttttgaaaacaagtatgcttacaataaaatgttggtagag
caaaacattactatagactcctcttgtgagcatcattttttaccaataacgggttttgca
cacattgcatatgtgccaaaagataaggttattgggttatctaaaataaataggttggta
gattattatgcgcacagaccacaggtacaagagcgtttgtctttgcaaatattaaaagac
cttcaaaatacattagagacacaagatgttatagttatggtaacagcaaaacacttatgt
gtatcatctagaggcataaaagacaaaaatagctttaccactacaatagaatacggtggt
tgttttaccaatgagcaaaccagaaacgactttttaaaaataatagagaaaacaacggta
taa

DBGET integrated database retrieval system