KEGG   Cellulophaga lytica: Celly_2290Help
Entry
Celly_2290        CDS       T01434                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cly  Cellulophaga lytica
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Celly_2290
Enzymes [BR:cly01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Celly_2290
Peptidases [BR:cly01002]
 Cysteine Peptidases
  Family C44
   Celly_2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2555124..2556788
Genome map
AA seq 554 aa AA seqDB search
MCGIVCAFDVKESTEALRPQLLEMSKKIRHRGPDWSGIYADDKAILAHERLAIVDPASGK
QPLLSPNGKLILAANGEIYNHRELRKQFEGKYDFQTESDCEVILALYQEKGVDFIDELNG
IFGFTIYDAEKDEYFVARDHMGIIPLYMGWDKNGTFYVASELKALEGTCTKIELFPPGHY
LHSKDGELKKWYSRDWMEYDAVKENETSIQEVKEALEAAVHRQLMSDVPYGVLLSGGLDS
SVTSAVAKKYAQKRIESGDTADAWYPQLHSFSVGLEGSPDLAAAKKVADHIGTVHHEIKF
TIQEGLDAIKDVIYNIETYDITTIRSSTPMYLMARVIKSMGIKMVLSGEGADELFGGYLY
FHKAPSAQEFHEETVRKLDKLHMYDCLRANKSLAAWGIEGRVPFLDKEFMDVAMRINPKD
KMINGERMEKWVVRKAFEDMIPESVAWRQKEQFSDGVGYSWIDTLKELVEKEITDEQIKN
AAFRFPINTPLNKEEYYYRTIFEGHFPSDAAALSVPQEASVACSTATALEWDEAFKNMND
PSGRAIANVHDEAY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatagtttgtgcatttgatgtaaaggaaagcactgaggcattaagacctcag
ttgttagagatgtctaaaaaaattagacacagaggccctgactggagtggtatatatgca
gacgataaagctattttagcacacgagcgtttggcaattgtagacccagcttctggtaag
caaccattattgagtcctaatggtaaattaatattggctgccaatggagaaatatataat
catagagaattgcgtaagcaatttgaaggtaaatatgactttcaaacagaatctgactgt
gaggttatactagctttgtaccaagaaaaaggagtagattttatagatgaattaaatggt
atttttggttttactatatatgatgccgaaaaagacgaatattttgtagctagagaccat
atgggaattattcctttatatatgggatgggataaaaatggaactttttatgttgcttca
gaattaaaagcattagaaggtacttgtacaaaaatagaattatttcctccaggacattat
ttacatagtaaagacggagagttaaaaaaatggtactctcgtgattggatggagtatgat
gctgttaaagaaaatgaaactagcatacaagaagtaaaagaagctttagaagcagctgta
cacagacaattaatgtctgatgtaccttacggtgtattgttatcaggtggtttagactct
tctgtgacttctgcggttgcaaaaaaatatgcacaaaaacgtatagaaagtggtgatact
gcagatgcttggtacccacaattacactcattctctgttggtttagaggggtcgccagat
ttggctgctgcaaaaaaagtagcagatcatataggtaccgtacaccacgaaattaagttt
acaatacaggaaggtttagatgctattaaagatgttatttataatatagaaacgtatgat
attactaccattcgttcttctacaccaatgtatttaatggcgagagttattaagtctatg
ggtataaaaatggtattgtctggtgaaggtgcagatgagctatttggaggttatttatat
tttcataaagcgccaagtgcacaagagtttcatgaagagacggtacgtaaattagataag
ttgcatatgtatgattgtttaagagctaacaagagtttagctgcttggggaattgaagga
cgtgtaccatttttagataaagaatttatggatgttgctatgcgtattaaccctaaagat
aaaatgataaacggtgagcgtatggaaaagtgggtagttcgtaaggcatttgaagatatg
ataccagaaagtgtagcgtggagacaaaaagaacagtttagtgatggcgttggttacagt
tggattgataccttaaaagaattggttgagaaagaaataacagatgagcaaattaaaaat
gcggcattccgttttcctatcaacaccccattaaacaaggaagagtattactatagaact
atttttgaaggacattttcctagtgatgctgcagcattaagtgtaccgcaagaagcaagt
gttgcttgtagtacagcaacagccttagaatgggatgaagcatttaaaaatatgaacgac
ccttctggtagagcaatagctaacgtacatgatgaagcatattaa

DBGET integrated database retrieval system